Citrus Sinensis ID: 032706
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| 461735 | 575 | RecName: Full=Chaperonin CPN60-1, mitoch | 0.807 | 0.189 | 0.481 | 6e-20 | |
| 357442731 | 574 | Chaperonin CPN60-like protein [Medicago | 0.851 | 0.200 | 0.456 | 1e-19 | |
| 449458874 | 575 | PREDICTED: chaperonin CPN60-2, mitochond | 0.851 | 0.2 | 0.456 | 3e-19 | |
| 461736 | 575 | RecName: Full=Chaperonin CPN60-2, mitoch | 0.851 | 0.2 | 0.456 | 3e-19 | |
| 161702919 | 526 | heat shock protein 60 [Ageratina adenoph | 0.851 | 0.218 | 0.456 | 3e-19 | |
| 15229559 | 577 | chaperonin CPN60 [Arabidopsis thaliana] | 0.851 | 0.199 | 0.448 | 5e-19 | |
| 16221 | 577 | chaperonin hsp60 [Arabidopsis thaliana] | 0.851 | 0.199 | 0.448 | 5e-19 | |
| 297835484 | 577 | hypothetical protein ARALYDRAFT_898985 [ | 0.851 | 0.199 | 0.448 | 5e-19 | |
| 24637539 | 545 | heat shock protein 60 [Prunus dulcis] | 0.851 | 0.211 | 0.456 | 7e-19 | |
| 359477860 | 571 | PREDICTED: chaperonin CPN60-2, mitochond | 0.851 | 0.201 | 0.448 | 7e-19 |
| >gi|461735|sp|Q05045.1|CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; Flags: Precursor gi|478785|pir||S29315 chaperonin 60 - cucurbit gi|12544|emb|CAA50217.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri] | Back alignment and taxonomy information |
|---|
Score = 102 bits (253), Expect = 6e-20, Method: Compositional matrix adjust.
Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 1/110 (0%)
Query: 19 EIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEG 78
++R+G+ MAVDSV+ NL A+MISTSEEIAQV T S NG+++IG L+A+ +E V K EG
Sbjct: 146 DLRRGISMAVDSVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGK-EG 204
Query: 79 HIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
I I++GK +L + G KLD GY S F+TN+K + C + +Y
Sbjct: 205 VITISDGKTMDNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPLIIIY 254
|
Source: Cucurbita cv. Kurokawa Amakuri Species: Cucurbita hybrid cultivar Genus: Cucurbita Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357442731|ref|XP_003591643.1| Chaperonin CPN60-like protein [Medicago truncatula] gi|92882357|gb|ABE86688.1| GroEL-like chaperone, ATPase [Medicago truncatula] gi|355480691|gb|AES61894.1| Chaperonin CPN60-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449458874|ref|XP_004147171.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus] gi|449498579|ref|XP_004160576.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|461736|sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; Flags: Precursor gi|478786|pir||S29316 chaperonin 60 - cucurbit gi|12546|emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri] | Back alignment and taxonomy information |
|---|
| >gi|161702919|gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora] | Back alignment and taxonomy information |
|---|
| >gi|15229559|ref|NP_189041.1| chaperonin CPN60 [Arabidopsis thaliana] gi|12644189|sp|P29197.2|CH60A_ARATH RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Full=HSP60; Flags: Precursor gi|9294668|dbj|BAB03017.1| chaperonin hsp60, mitochondrial precursor (HSP60) [Arabidopsis thaliana] gi|20466256|gb|AAM20445.1| mitochondrial chaperonin hsp60 [Arabidopsis thaliana] gi|34098917|gb|AAQ56841.1| At3g23990 [Arabidopsis thaliana] gi|332643321|gb|AEE76842.1| chaperonin CPN60 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|16221|emb|CAA77646.1| chaperonin hsp60 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297835484|ref|XP_002885624.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. lyrata] gi|297331464|gb|EFH61883.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|24637539|gb|AAN63805.1| heat shock protein 60 [Prunus dulcis] | Back alignment and taxonomy information |
|---|
| >gi|359477860|ref|XP_003632036.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| TAIR|locus:2076081 | 577 | HSP60 "heat shock protein 60" | 0.777 | 0.181 | 0.490 | 5.9e-20 | |
| TAIR|locus:2046590 | 585 | HSP60-2 "heat shock protein 60 | 0.777 | 0.179 | 0.481 | 2.1e-19 | |
| CGD|CAL0001744 | 566 | HSP60 [Candida albicans (taxid | 0.888 | 0.212 | 0.425 | 4.4e-16 | |
| UNIPROTKB|O74261 | 566 | HSP60 "Heat shock protein 60, | 0.888 | 0.212 | 0.425 | 4.4e-16 | |
| MGI|MGI:96242 | 573 | Hspd1 "heat shock protein 1 (c | 0.918 | 0.216 | 0.370 | 4.6e-16 | |
| RGD|621314 | 573 | Hspd1 "heat shock protein 1 (c | 0.918 | 0.216 | 0.370 | 4.6e-16 | |
| UNIPROTKB|P63039 | 573 | Hspd1 "60 kDa heat shock prote | 0.918 | 0.216 | 0.370 | 4.6e-16 | |
| POMBASE|SPAC12G12.04 | 582 | mcp60 "mitochondrial heat shoc | 0.785 | 0.182 | 0.444 | 4.7e-16 | |
| UNIPROTKB|D4ABH6 | 565 | D4ABH6 "Uncharacterized protei | 0.918 | 0.219 | 0.370 | 9.3e-16 | |
| UNIPROTKB|F1MUZ9 | 573 | HSPD1 "60 kDa heat shock prote | 0.918 | 0.216 | 0.362 | 1.2e-15 |
| TAIR|locus:2076081 HSP60 "heat shock protein 60" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 245 (91.3 bits), Expect = 5.9e-20, P = 5.9e-20
Identities = 52/106 (49%), Positives = 74/106 (69%)
Query: 13 AELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIEL 72
A ++ ++R+G+ MAVD+V+ NL A+MISTSEEIAQV T S NG+++IG L+A+ +E
Sbjct: 139 AGMNAMDLRRGISMAVDAVVTNLKSKARMISTSEEIAQVGTISANGEREIGELIAKAMEK 198
Query: 73 VRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLC 118
V K EG I I +GK +L + G KLD GY+S F+TN+K + C
Sbjct: 199 VGK-EGVITIQDGKTLFNELEVVEGMKLDRGYTSPYFITNQKTQKC 243
|
|
| TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001744 HSP60 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O74261 HSP60 "Heat shock protein 60, mitochondrial" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96242 Hspd1 "heat shock protein 1 (chaperonin)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621314 Hspd1 "heat shock protein 1 (chaperonin)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63039 Hspd1 "60 kDa heat shock protein, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC12G12.04 mcp60 "mitochondrial heat shock protein Hsp60/Mcp60" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ABH6 D4ABH6 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MUZ9 HSPD1 "60 kDa heat shock protein, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| cd03344 | 520 | cd03344, GroEL, GroEL_like type I chaperonin | 4e-23 | |
| PTZ00114 | 555 | PTZ00114, PTZ00114, Heat shock protein 60; Provisi | 4e-21 | |
| PRK12849 | 542 | PRK12849, groEL, chaperonin GroEL; Reviewed | 9e-20 | |
| TIGR02348 | 524 | TIGR02348, GroEL, chaperonin GroL | 4e-19 | |
| PRK00013 | 542 | PRK00013, groEL, chaperonin GroEL; Reviewed | 1e-18 | |
| PRK12852 | 545 | PRK12852, groEL, chaperonin GroEL; Reviewed | 5e-18 | |
| PRK12850 | 544 | PRK12850, groEL, chaperonin GroEL; Reviewed | 8e-18 | |
| PRK12851 | 541 | PRK12851, groEL, chaperonin GroEL; Reviewed | 1e-17 | |
| PRK14104 | 546 | PRK14104, PRK14104, chaperonin GroEL; Provisional | 8e-16 | |
| CHL00093 | 529 | CHL00093, groEL, chaperonin GroEL | 4e-12 | |
| COG0459 | 524 | COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po | 7e-10 | |
| cd00309 | 464 | cd00309, chaperonin_type_I_II, chaperonin families | 3e-07 | |
| PLN03167 | 600 | PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr | 5e-05 | |
| pfam00118 | 481 | pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami | 6e-05 |
| >gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin | Back alignment and domain information |
|---|
Score = 92.9 bits (232), Expect = 4e-23
Identities = 44/117 (37%), Positives = 71/117 (60%), Gaps = 1/117 (0%)
Query: 12 NAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIE 71
A + ++++G++ AV++V+E L + ++ + T EEIAQVAT S NGD++IG L+A +E
Sbjct: 105 AAGANPMDLKRGIEKAVEAVVEELKKLSKPVKTKEEIAQVATISANGDEEIGELIAEAME 164
Query: 72 LVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
V K +G I + EGK +L + G + D GY S FVT+ +K + Y+ L
Sbjct: 165 KVGK-DGVITVEEGKTLETELEVVEGMQFDRGYLSPYFVTDPEKMEVELENPYILLT 220
|
Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520 |
| >gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL | Back alignment and domain information |
|---|
| >gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL | Back alignment and domain information |
|---|
| >gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| KOG0356 | 550 | consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ | 100.0 | |
| PLN03167 | 600 | Chaperonin-60 beta subunit; Provisional | 99.97 | |
| PRK14104 | 546 | chaperonin GroEL; Provisional | 99.96 | |
| CHL00093 | 529 | groEL chaperonin GroEL | 99.96 | |
| PRK12852 | 545 | groEL chaperonin GroEL; Reviewed | 99.96 | |
| PTZ00114 | 555 | Heat shock protein 60; Provisional | 99.96 | |
| COG0459 | 524 | GroL Chaperonin GroEL (HSP60 family) [Posttranslat | 99.95 | |
| TIGR02348 | 524 | GroEL chaperonin GroL. This family consists of Gro | 99.94 | |
| PRK00013 | 542 | groEL chaperonin GroEL; Reviewed | 99.94 | |
| PRK12850 | 544 | groEL chaperonin GroEL; Reviewed | 99.94 | |
| PRK12851 | 541 | groEL chaperonin GroEL; Reviewed | 99.93 | |
| PRK12849 | 542 | groEL chaperonin GroEL; Reviewed | 99.93 | |
| cd03344 | 520 | GroEL GroEL_like type I chaperonin. Chaperonins ar | 99.92 | |
| TIGR02345 | 522 | chap_CCT_eta T-complex protein 1, eta subunit. Mem | 99.81 | |
| cd03342 | 484 | TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper | 99.81 | |
| cd03343 | 517 | cpn60 cpn60 chaperonin family. Chaperonins are inv | 99.76 | |
| cd03338 | 515 | TCP1_delta TCP-1 (CTT or eukaryotic type II) chape | 99.75 | |
| TIGR02347 | 531 | chap_CCT_zeta T-complex protein 1, zeta subunit. M | 99.74 | |
| TIGR02340 | 536 | chap_CCT_alpha T-complex protein 1, alpha subunit. | 99.73 | |
| cd00309 | 464 | chaperonin_type_I_II chaperonin families, type I a | 99.72 | |
| cd03340 | 522 | TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero | 99.72 | |
| PTZ00212 | 533 | T-complex protein 1 subunit beta; Provisional | 99.71 | |
| TIGR02339 | 519 | thermosome_arch thermosome, various subunits, arch | 99.7 | |
| TIGR02341 | 519 | chap_CCT_beta T-complex protein 1, beta subunit. M | 99.67 | |
| TIGR02346 | 531 | chap_CCT_theta T-complex protein 1, theta subunit. | 99.67 | |
| cd03339 | 526 | TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha | 99.62 | |
| cd03335 | 527 | TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape | 99.6 | |
| cd03336 | 517 | TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper | 99.59 | |
| TIGR02343 | 532 | chap_CCT_epsi T-complex protein 1, epsilon subunit | 99.57 | |
| TIGR02342 | 517 | chap_CCT_delta T-complex protein 1, delta subunit. | 99.51 | |
| cd03337 | 480 | TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape | 99.49 | |
| TIGR02344 | 525 | chap_CCT_gamma T-complex protein 1, gamma subunit. | 99.48 | |
| cd03341 | 472 | TCP1_theta TCP-1 (CTT or eukaryotic type II) chape | 99.44 | |
| PF00118 | 485 | Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon | 99.42 | |
| cd03333 | 209 | chaperonin_like chaperonin_like superfamily. Chape | 98.82 | |
| KOG0359 | 520 | consensus Chaperonin complex component, TCP-1 zeta | 96.9 | |
| KOG0361 | 543 | consensus Chaperonin complex component, TCP-1 eta | 95.43 | |
| KOG0364 | 527 | consensus Chaperonin complex component, TCP-1 gamm | 93.84 | |
| KOG0362 | 537 | consensus Chaperonin complex component, TCP-1 thet | 92.12 | |
| KOG3083 | 271 | consensus Prohibitin [Posttranslational modificati | 88.08 | |
| KOG0358 | 534 | consensus Chaperonin complex component, TCP-1 delt | 82.98 | |
| KOG0363 | 527 | consensus Chaperonin complex component, TCP-1 beta | 81.02 | |
| cd03334 | 261 | Fab1_TCP TCP-1 like domain of the eukaryotic phosp | 80.73 |
| >KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-42 Score=302.08 Aligned_cols=130 Identities=35% Similarity=0.552 Sum_probs=127.6
Q ss_pred cccccchhhhccCCChHHHHHHHHHHHHHHHHHHhhcccccCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEE
Q 032706 2 CNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIF 81 (135)
Q Consensus 2 ~~eg~~l~~v~aG~nP~~l~rGi~~A~~~v~~~L~~~a~~v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvIt 81 (135)
..|| .+.+++|+||+++||||.+|++.+++.|+++|+||+++++|+|||+||||||.++|++|++||++||+ +|+||
T Consensus 113 ~~eg--~~~v~~G~npv~irrGi~~av~~vv~~L~k~sk~Vtt~eeIaqVAtiSAngD~~ig~li~~a~~kvG~-~GVIt 189 (550)
T KOG0356|consen 113 AKEG--FEKVAKGANPVEIRRGIMLAVDAVVDELKKMSKPVTTPEEIAQVATISANGDKEIGNLISDAMKKVGR-KGVIT 189 (550)
T ss_pred HHHH--HHHHhccCCchhhhhhHHHHHHHHHHHHHHhCCCCCCHHHHHHHHhhhcCCcHHHHHHHHHHHHHhCc-CCeEE
Confidence 4678 89999999999999999999999999999999999999999999999999999999999999999999 99999
Q ss_pred EecCCCCCeEEEEeeeeEecCccccceeeecCCCceEEeeceeEEEecccccC
Q 032706 82 ITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRL 134 (135)
Q Consensus 82 vee~~~~~~~le~~eG~~fd~GYlSpyfvTd~~~~~~~l~~p~ILitd~kIs~ 134 (135)
|++|++..++|+++|||+|||||+||||+|+++.+.++|+||++|++|+||++
T Consensus 190 v~~gkt~~delev~eGmkfdrGyiSPyfi~~~k~~~~e~e~~~~ll~~kki~~ 242 (550)
T KOG0356|consen 190 VKDGKTLEDELEVIEGMKFDRGYISPYFITSSKKQKVEFENALLLLSEKKISS 242 (550)
T ss_pred eecCCccccchhhhhcccccccccCccccccchhhhhhhhhhhhhhhhhhhhH
Confidence 99999999999999999999999999999999999999999999999999985
|
|
| >PLN03167 Chaperonin-60 beta subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14104 chaperonin GroEL; Provisional | Back alignment and domain information |
|---|
| >CHL00093 groEL chaperonin GroEL | Back alignment and domain information |
|---|
| >PRK12852 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PTZ00114 Heat shock protein 60; Provisional | Back alignment and domain information |
|---|
| >COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02348 GroEL chaperonin GroL | Back alignment and domain information |
|---|
| >PRK00013 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12850 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12851 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >PRK12849 groEL chaperonin GroEL; Reviewed | Back alignment and domain information |
|---|
| >cd03344 GroEL GroEL_like type I chaperonin | Back alignment and domain information |
|---|
| >TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit | Back alignment and domain information |
|---|
| >cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit | Back alignment and domain information |
|---|
| >cd03343 cpn60 cpn60 chaperonin family | Back alignment and domain information |
|---|
| >cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit | Back alignment and domain information |
|---|
| >TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit | Back alignment and domain information |
|---|
| >TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit | Back alignment and domain information |
|---|
| >cd00309 chaperonin_type_I_II chaperonin families, type I and type II | Back alignment and domain information |
|---|
| >cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit | Back alignment and domain information |
|---|
| >PTZ00212 T-complex protein 1 subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02339 thermosome_arch thermosome, various subunits, archaeal | Back alignment and domain information |
|---|
| >TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit | Back alignment and domain information |
|---|
| >TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit | Back alignment and domain information |
|---|
| >cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit | Back alignment and domain information |
|---|
| >cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit | Back alignment and domain information |
|---|
| >cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit | Back alignment and domain information |
|---|
| >TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit | Back alignment and domain information |
|---|
| >cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit | Back alignment and domain information |
|---|
| >TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit | Back alignment and domain information |
|---|
| >cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit | Back alignment and domain information |
|---|
| >PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism | Back alignment and domain information |
|---|
| >cd03333 chaperonin_like chaperonin_like superfamily | Back alignment and domain information |
|---|
| >KOG0359 consensus Chaperonin complex component, TCP-1 zeta subunit (CCT6) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0361 consensus Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0364 consensus Chaperonin complex component, TCP-1 gamma subunit (CCT3) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0362 consensus Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3083 consensus Prohibitin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0358 consensus Chaperonin complex component, TCP-1 delta subunit (CCT4) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0363 consensus Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 135 | ||||
| 1iok_A | 545 | Crystal Structure Of Chaperonin-60 From Paracoccus | 9e-11 | ||
| 3rtk_A | 546 | Crystal Structure Of Cpn60.2 From Mycobacterium Tub | 2e-10 | ||
| 1sjp_A | 504 | Mycobacterium Tuberculosis Chaperonin60.2 Length = | 2e-10 | ||
| 1we3_A | 543 | Crystal Structure Of The Chaperonin Complex Cpn60CP | 1e-08 | ||
| 2yey_A | 524 | Crystal Structure Of The Allosteric-Defective Chape | 5e-08 | ||
| 2eu1_A | 548 | Crystal Structure Of The Chaperonin Groel-E461k Len | 5e-08 | ||
| 1j4z_A | 547 | Structural And Mechanistic Basis For Allostery In T | 5e-08 | ||
| 4aaq_A | 548 | Atp-Triggered Molecular Mechanics Of The Chaperonin | 5e-08 | ||
| 1pcq_A | 524 | Crystal Structure Of Groel-Groes Length = 524 | 5e-08 | ||
| 1aon_A | 547 | Crystal Structure Of The Asymmetric Chaperonin Comp | 5e-08 | ||
| 3c9v_A | 526 | C7 Symmetrized Structure Of Unliganded Groel At 4.7 | 5e-08 | ||
| 1ss8_A | 524 | Groel Length = 524 | 1e-07 | ||
| 1grl_A | 548 | The Crystal Structure Of The Bacterial Chaperonin G | 1e-07 | ||
| 1oel_A | 547 | Conformational Variability In The Refined Structure | 1e-07 | ||
| 1kp8_A | 547 | Structural Basis For Groel-Assisted Protein Folding | 1e-07 | ||
| 1sx3_A | 525 | Groel14-(Atpgammas)14 Length = 525 | 1e-07 | ||
| 3cau_A | 526 | D7 Symmetrized Structure Of Unliganded Groel At 4.2 | 1e-07 | ||
| 1gr5_A | 547 | Solution Structure Of Apo Groel By Cryo-Electron Mi | 1e-07 |
| >pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 | Back alignment and structure |
|
| >pdb|3RTK|A Chain A, Crystal Structure Of Cpn60.2 From Mycobacterium Tuberculosis At 2.8a Length = 546 | Back alignment and structure |
| >pdb|1SJP|A Chain A, Mycobacterium Tuberculosis Chaperonin60.2 Length = 504 | Back alignment and structure |
| >pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 | Back alignment and structure |
| >pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin Groel E434k Mutant Length = 524 | Back alignment and structure |
| >pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 | Back alignment and structure |
| >pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 | Back alignment and structure |
| >pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel Length = 548 | Back alignment and structure |
| >pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 | Back alignment and structure |
| >pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 | Back alignment and structure |
| >pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 | Back alignment and structure |
| >pdb|1SS8|A Chain A, Groel Length = 524 | Back alignment and structure |
| >pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 | Back alignment and structure |
| >pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 | Back alignment and structure |
| >pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 | Back alignment and structure |
| >pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 | Back alignment and structure |
| >pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 | Back alignment and structure |
| >pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 3e-20 | |
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 2e-19 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 3e-17 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 3e-17 |
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 | Back alignment and structure |
|---|
Score = 84.2 bits (209), Expect = 3e-20
Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
Query: 19 EIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEG 78
++++G+ +A V+E + +A+ ++ S E+AQV T S NG+ IG +A ++ V EG
Sbjct: 115 DLKRGIDVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGN-EG 173
Query: 79 HIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
I + E K ++ + G + D GY S FVTN K + Y+ L+
Sbjct: 174 VITVEENKGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLH 223
|
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 | Back alignment and structure |
|---|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| 1kp8_A | 547 | Groel protein; chaperonin, assisted protein foldin | 100.0 | |
| 3rtk_A | 546 | 60 kDa chaperonin 2; heat shock protein, chaperone | 100.0 | |
| 1iok_A | 545 | Chaperonin 60; chaperone; 3.20A {Paracoccus denitr | 100.0 | |
| 1we3_A | 543 | CPN60(groel); chaperonin, chaperone, groel, HSP60, | 100.0 | |
| 3iyg_H | 515 | T-complex protein 1 subunit ETA; TRIC/CCT, asymmet | 99.93 | |
| 3p9d_G | 550 | T-complex protein 1 subunit ETA; HSP60, eukaryotic | 99.93 | |
| 3p9d_D | 528 | T-complex protein 1 subunit delta; HSP60, eukaryot | 99.91 | |
| 3ruv_A | 543 | Chaperonin, CPN; double-ring, protein folding mach | 99.91 | |
| 3ko1_A | 553 | Chaperonin; 9-fold symmetry, double ring, ATP hydr | 99.91 | |
| 3p9d_B | 527 | T-complex protein 1 subunit beta; HSP60, eukaryoti | 99.91 | |
| 1a6d_A | 545 | Thermosome (alpha subunit); group II chaperonin, C | 99.9 | |
| 3iyg_E | 515 | T-complex protein 1 subunit; TRIC/CCT, asymmetric, | 99.9 | |
| 1q3q_A | 548 | Thermosome alpha subunit; chaperone, chaperonin; H | 99.89 | |
| 3aq1_B | 500 | Thermosome subunit; group II chaperonin, protein f | 99.89 | |
| 1a6d_B | 543 | Thermosome (beta subunit); group II chaperonin, CC | 99.89 | |
| 3iyg_Q | 512 | T-complex protein 1 subunit theta; TRIC/CCT, asymm | 99.89 | |
| 3iyg_Z | 517 | T-complex protein 1 subunit zeta; TRIC/CCT, asymme | 99.89 | |
| 3iyg_B | 513 | T-complex protein 1 subunit beta; TRIC/CCT, asymme | 99.88 | |
| 3p9d_A | 559 | T-complex protein 1 subunit alpha; HSP60, eukaryot | 99.88 | |
| 3iyg_D | 518 | T-complex protein 1 subunit delta; TRIC/CCT, asymm | 99.88 | |
| 3m6c_A | 194 | 60 kDa chaperonin 1; chaperone, ATP-binding, nucle | 99.88 | |
| 3iyg_A | 529 | T-complex protein 1 subunit alpha; TRIC/CCT, asymm | 99.87 | |
| 3p9d_E | 562 | T-complex protein 1 subunit epsilon; HSP60, eukary | 99.86 | |
| 3p9d_C | 590 | T-complex protein 1 subunit gamma; HSP60, eukaryot | 99.83 | |
| 3osx_A | 201 | 60 kDa chaperonin; alpha, beta, apical domain, cha | 99.83 | |
| 3p9d_F | 546 | T-complex protein 1 subunit zeta; HSP60, eukaryoti | 99.82 | |
| 3iyg_G | 515 | T-complex protein 1 subunit gamma; TRIC/CCT, asymm | 99.81 | |
| 3p9d_H | 568 | T-complex protein 1 subunit theta; HSP60, eukaryot | 99.76 |
| >1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-34 Score=253.51 Aligned_cols=130 Identities=28% Similarity=0.445 Sum_probs=126.9
Q ss_pred cccccchhhhccCCChHHHHHHHHHHHHHHHHHHhhcccccCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEE
Q 032706 2 CNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIF 81 (135)
Q Consensus 2 ~~eg~~l~~v~aG~nP~~l~rGi~~A~~~v~~~L~~~a~~v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvIt 81 (135)
++|| ++++++|+||+.|++|+++|++.+++.|+++|+||++.++|.+||++|+|+|+.+|+|+++||.+||+ +|+|+
T Consensus 99 l~ea--~~lv~~GihP~~I~~G~~~A~~~a~~~L~~~s~~v~~~e~l~~vA~iS~~~~~~i~~liadAv~~V~~-dg~I~ 175 (547)
T 1kp8_A 99 ITEG--LKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGK-EGVIT 175 (547)
T ss_dssp HHHH--HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHCBCCCSHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCT-TSEEE
T ss_pred HHHH--HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHhCcCCCCHHHHHHHHHHhccchhHHHHHHHHHHHHhCc-CCcEE
Confidence 5678 89999999999999999999999999999999999999999999999999899999999999999999 99999
Q ss_pred EecCCCCCeEEEEeeeeEecCccccceeeecCCCceEEeeceeEEEecccccC
Q 032706 82 ITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRL 134 (135)
Q Consensus 82 vee~~~~~~~le~~eG~~fd~GYlSpyfvTd~~~~~~~l~~p~ILitd~kIs~ 134 (135)
|++|+++++++++++||+||+||+||||+|++++|.++++|||||++|.+|++
T Consensus 176 Ve~G~~~~ds~~lveG~~fdkg~~~p~~vt~~~~m~~~lenp~Ill~d~~Is~ 228 (547)
T 1kp8_A 176 VEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISN 228 (547)
T ss_dssp EECCSSSSCEEEEESCEEESCCBSSTTCCSBTTTTBEEEESCEEECEESEECC
T ss_pred EEeCCccccccEEEecEEEecCccccccccCcccCceEecCceEEEEcCcCCC
Confidence 99999999999999999999999999999999999999999999999999986
|
| >3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A | Back alignment and structure |
|---|
| >1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 | Back alignment and structure |
|---|
| >1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* | Back alignment and structure |
|---|
| >3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* | Back alignment and structure |
|---|
| >3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* | Back alignment and structure |
|---|
| >3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A | Back alignment and structure |
|---|
| >3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} | Back alignment and structure |
|---|
| >3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* | Back alignment and structure |
|---|
| >1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* | Back alignment and structure |
|---|
| >3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A | Back alignment and structure |
|---|
| >3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} | Back alignment and structure |
|---|
| >1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B | Back alignment and structure |
|---|
| >3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A | Back alignment and structure |
|---|
| >3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* | Back alignment and structure |
|---|
| >3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* | Back alignment and structure |
|---|
| >3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B | Back alignment and structure |
|---|
| >3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} SCOP: c.8.5.1 PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A | Back alignment and structure |
|---|
| >3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* | Back alignment and structure |
|---|
| >3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} | Back alignment and structure |
|---|
| >3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 135 | ||||
| d1sjpa3 | 89 | d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {My | 2e-13 | |
| d1kp8a3 | 97 | d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Es | 9e-10 | |
| d1ioka3 | 97 | d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Pa | 5e-09 | |
| d1we3a3 | 86 | d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Th | 1e-06 |
| >d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 89 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: GroEL-intermediate domain like superfamily: GroEL-intermediate domain like family: GroEL-like chaperone, intermediate domain domain: GroEL, I domain species: Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]
Score = 59.4 bits (144), Expect = 2e-13
Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
Query: 42 ISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLD 101
+ T E+IA A S GD+ IG L+A ++ V EG I + E G++L L +
Sbjct: 2 VETKEQIAATAAIS-AGDQSIGDLIAEAMDKVGN-EGVITVEESNTFGLQLELTEVAVIK 59
Query: 102 WGYSSSCFVTNKKKKL 117
G ++ + +K ++
Sbjct: 60 AGAATEVELKERKHRI 75
|
| >d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Length = 97 | Back information, alignment and structure |
|---|
| >d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Length = 97 | Back information, alignment and structure |
|---|
| >d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| d1sjpa3 | 89 | GroEL, I domain {Mycobacterium tuberculosis, GroEL | 100.0 | |
| d1kp8a3 | 97 | GroEL, I domain {Escherichia coli [TaxId: 562]} | 99.97 | |
| d1we3a3 | 86 | GroEL, I domain {Thermus thermophilus [TaxId: 274] | 99.97 | |
| d1ioka3 | 97 | GroEL, I domain {Paracoccus denitrificans [TaxId: | 99.97 | |
| d1kp8a1 | 252 | GroEL, E domain {Escherichia coli [TaxId: 562]} | 99.89 | |
| d1ioka1 | 252 | GroEL, E domain {Paracoccus denitrificans [TaxId: | 99.79 | |
| d1we3a1 | 255 | GroEL, E domain {Thermus thermophilus [TaxId: 274] | 99.77 | |
| d1kida_ | 193 | GroEL, A domain {Escherichia coli [TaxId: 562]} | 99.76 | |
| d1q3qa1 | 258 | Thermosome, E domain {Archaeon Thermococcus sp. ks | 99.68 | |
| d1sjpa1 | 180 | GroEL, E domain {Mycobacterium tuberculosis, GroEL | 98.52 | |
| d1a6da1 | 245 | Thermosome, E domain {Archaeon Thermoplasma acidop | 98.11 | |
| d1a6db1 | 243 | Thermosome, E domain {Archaeon Thermoplasma acidop | 97.52 |
| >d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: GroEL-intermediate domain like superfamily: GroEL-intermediate domain like family: GroEL-like chaperone, intermediate domain domain: GroEL, I domain species: Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]
Probab=100.00 E-value=1.2e-38 Score=220.32 Aligned_cols=86 Identities=24% Similarity=0.308 Sum_probs=83.0
Q ss_pred cCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEEEecCCCCCeEEEEeeeeEecCccccceeeecC-CCceEEe
Q 032706 42 ISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNK-KKKLCFQ 120 (135)
Q Consensus 42 v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvItvee~~~~~~~le~~eG~~fd~GYlSpyfvTd~-~~~~~~l 120 (135)
|+++++|+||||||| ||+.||++||+||++||+ +|+||+|+|++.++++++++||+||+||+||||+||+ +|++++|
T Consensus 2 V~~~e~i~~VAtISa-~D~~iG~lIa~A~~kVG~-dGvItvEe~~~~~t~le~veG~~~d~Gy~Sp~fvtd~k~r~e~~l 79 (89)
T d1sjpa3 2 VETKEQIAATAAISA-GDQSIGDLIAEAMDKVGN-EGVITVEESNTFGLQLELTEVAVIKAGAATEVELKERKHRIEDAV 79 (89)
T ss_dssp CCSHHHHHHHHHHHT-TCHHHHHHHHHHHHHSCT-TSCEEEEEESSSSEEEEEESEEEEEEECSSHHHHHHHHHHHHHHH
T ss_pred CCCHHHHHHhhheec-CCHHHHHHHHHHHHhcCC-CCceEEEeccccceEEEEEEEEEecCCccCceEEcccHHhhHHHH
Confidence 688999999999999 699999999999999999 9999999999999999999999999999999999985 7889999
Q ss_pred eceeEEEec
Q 032706 121 SSTYLFLYG 129 (135)
Q Consensus 121 ~~p~ILitd 129 (135)
+||||||+|
T Consensus 80 ~~p~ili~d 88 (89)
T d1sjpa3 80 RNAKAAVEE 88 (89)
T ss_dssp HHHHHHHHH
T ss_pred hCceEeeec
Confidence 999999987
|
| >d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} | Back information, alignment and structure |
|---|
| >d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} | Back information, alignment and structure |
|---|