Citrus Sinensis ID: 032706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MCNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRLE
ccHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHEEEEEccccHHHHHHHHHHHHHHccccccEEEEccccccEEEEEEEccccccccccccccccccccEEEcccEEEEEEEcEEccc
cccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEccccccccccccEEEccHccEEEEEcccEEEEEccEEEcc
MCNEGRNLLlenaelddteiRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHifitegkepgvklnlysgfkldwgyssscfvtnkkkklcfqsSTYLFLYGETFRLE
mcnegrnlllenaelddteirKGVQMAVDSVLENLSRSAQMISTSEEIAQVAttsingdkdIGALVARTIELVRKAEGhifitegkepgvkLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSStylflygetfrle
MCNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRLE
***********************************************IAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETF***
MCNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLS*************QVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRL*
MCNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRLE
****GRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q05045 575 Chaperonin CPN60-1, mitoc N/A no 0.807 0.189 0.481 8e-22
Q05046 575 Chaperonin CPN60-2, mitoc N/A no 0.851 0.2 0.456 4e-21
P29197 577 Chaperonin CPN60, mitocho yes no 0.851 0.199 0.448 7e-21
Q8L7B5 585 Chaperonin CPN60-like 1, no no 0.851 0.196 0.439 2e-20
Q43298 576 Chaperonin CPN60-2, mitoc N/A no 0.851 0.199 0.439 1e-19
P29185 577 Chaperonin CPN60-1, mitoc N/A no 0.851 0.199 0.439 2e-19
Q09864 582 Heat shock protein 60, mi yes no 0.792 0.183 0.440 2e-16
O74261 566 Heat shock protein 60, mi N/A no 0.896 0.213 0.421 3e-16
Q93ZM7 572 Chaperonin CPN60-like 2, no no 0.807 0.190 0.4 1e-15
Q9VMN5 576 60 kDa heat shock protein yes no 0.8 0.187 0.418 1e-15
>sp|Q05045|CH61_CUCMA Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 19  EIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEG 78
           ++R+G+ MAVDSV+ NL   A+MISTSEEIAQV T S NG+++IG L+A+ +E V K EG
Sbjct: 146 DLRRGISMAVDSVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGK-EG 204

Query: 79  HIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
            I I++GK    +L +  G KLD GY S  F+TN+K + C      + +Y
Sbjct: 205 VITISDGKTMDNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPLIIIY 254
Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.
Cucurbita maxima (taxid: 3661)
>sp|Q05046|CH62_CUCMA Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1 Back     alignment and function description
>sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2 Back     alignment and function description
>sp|Q8L7B5|CH60B_ARATH Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=1 SV=1 Back     alignment and function description
>sp|Q43298|CH62_MAIZE Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1 Back     alignment and function description
>sp|P29185|CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2 Back     alignment and function description
>sp|Q09864|HSP60_SCHPO Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp60 PE=1 SV=1 Back     alignment and function description
>sp|O74261|HSP60_CANAL Heat shock protein 60, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP60 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZM7|CH60C_ARATH Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=1 SV=2 Back     alignment and function description
>sp|Q9VMN5|CH60C_DROME 60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster GN=Hsp60C PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
461735 575 RecName: Full=Chaperonin CPN60-1, mitoch 0.807 0.189 0.481 6e-20
357442731 574 Chaperonin CPN60-like protein [Medicago 0.851 0.200 0.456 1e-19
449458874 575 PREDICTED: chaperonin CPN60-2, mitochond 0.851 0.2 0.456 3e-19
461736 575 RecName: Full=Chaperonin CPN60-2, mitoch 0.851 0.2 0.456 3e-19
161702919 526 heat shock protein 60 [Ageratina adenoph 0.851 0.218 0.456 3e-19
15229559 577 chaperonin CPN60 [Arabidopsis thaliana] 0.851 0.199 0.448 5e-19
16221 577 chaperonin hsp60 [Arabidopsis thaliana] 0.851 0.199 0.448 5e-19
297835484 577 hypothetical protein ARALYDRAFT_898985 [ 0.851 0.199 0.448 5e-19
24637539 545 heat shock protein 60 [Prunus dulcis] 0.851 0.211 0.456 7e-19
359477860 571 PREDICTED: chaperonin CPN60-2, mitochond 0.851 0.201 0.448 7e-19
>gi|461735|sp|Q05045.1|CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; Flags: Precursor gi|478785|pir||S29315 chaperonin 60 - cucurbit gi|12544|emb|CAA50217.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information
 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 19  EIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEG 78
           ++R+G+ MAVDSV+ NL   A+MISTSEEIAQV T S NG+++IG L+A+ +E V K EG
Sbjct: 146 DLRRGISMAVDSVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGK-EG 204

Query: 79  HIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
            I I++GK    +L +  G KLD GY S  F+TN+K + C      + +Y
Sbjct: 205 VITISDGKTMDNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPLIIIY 254

Source: Cucurbita cv. Kurokawa Amakuri

Species: Cucurbita hybrid cultivar

Genus: Cucurbita

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357442731|ref|XP_003591643.1| Chaperonin CPN60-like protein [Medicago truncatula] gi|92882357|gb|ABE86688.1| GroEL-like chaperone, ATPase [Medicago truncatula] gi|355480691|gb|AES61894.1| Chaperonin CPN60-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449458874|ref|XP_004147171.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus] gi|449498579|ref|XP_004160576.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|461736|sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; Flags: Precursor gi|478786|pir||S29316 chaperonin 60 - cucurbit gi|12546|emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information
>gi|161702919|gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora] Back     alignment and taxonomy information
>gi|15229559|ref|NP_189041.1| chaperonin CPN60 [Arabidopsis thaliana] gi|12644189|sp|P29197.2|CH60A_ARATH RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Full=HSP60; Flags: Precursor gi|9294668|dbj|BAB03017.1| chaperonin hsp60, mitochondrial precursor (HSP60) [Arabidopsis thaliana] gi|20466256|gb|AAM20445.1| mitochondrial chaperonin hsp60 [Arabidopsis thaliana] gi|34098917|gb|AAQ56841.1| At3g23990 [Arabidopsis thaliana] gi|332643321|gb|AEE76842.1| chaperonin CPN60 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|16221|emb|CAA77646.1| chaperonin hsp60 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835484|ref|XP_002885624.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. lyrata] gi|297331464|gb|EFH61883.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|24637539|gb|AAN63805.1| heat shock protein 60 [Prunus dulcis] Back     alignment and taxonomy information
>gi|359477860|ref|XP_003632036.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 2 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2076081 577 HSP60 "heat shock protein 60" 0.777 0.181 0.490 5.9e-20
TAIR|locus:2046590 585 HSP60-2 "heat shock protein 60 0.777 0.179 0.481 2.1e-19
CGD|CAL0001744 566 HSP60 [Candida albicans (taxid 0.888 0.212 0.425 4.4e-16
UNIPROTKB|O74261 566 HSP60 "Heat shock protein 60, 0.888 0.212 0.425 4.4e-16
MGI|MGI:96242 573 Hspd1 "heat shock protein 1 (c 0.918 0.216 0.370 4.6e-16
RGD|621314 573 Hspd1 "heat shock protein 1 (c 0.918 0.216 0.370 4.6e-16
UNIPROTKB|P63039 573 Hspd1 "60 kDa heat shock prote 0.918 0.216 0.370 4.6e-16
POMBASE|SPAC12G12.04 582 mcp60 "mitochondrial heat shoc 0.785 0.182 0.444 4.7e-16
UNIPROTKB|D4ABH6 565 D4ABH6 "Uncharacterized protei 0.918 0.219 0.370 9.3e-16
UNIPROTKB|F1MUZ9 573 HSPD1 "60 kDa heat shock prote 0.918 0.216 0.362 1.2e-15
TAIR|locus:2076081 HSP60 "heat shock protein 60" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 5.9e-20, P = 5.9e-20
 Identities = 52/106 (49%), Positives = 74/106 (69%)

Query:    13 AELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIEL 72
             A ++  ++R+G+ MAVD+V+ NL   A+MISTSEEIAQV T S NG+++IG L+A+ +E 
Sbjct:   139 AGMNAMDLRRGISMAVDAVVTNLKSKARMISTSEEIAQVGTISANGEREIGELIAKAMEK 198

Query:    73 VRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLC 118
             V K EG I I +GK    +L +  G KLD GY+S  F+TN+K + C
Sbjct:   199 VGK-EGVITIQDGKTLFNELEVVEGMKLDRGYTSPYFITNQKTQKC 243
GO:0005524 "ATP binding" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=IEA;RCA
GO:0042026 "protein refolding" evidence=IEA
GO:0044267 "cellular protein metabolic process" evidence=IEA
GO:0051131 "chaperone-mediated protein complex assembly" evidence=TAS
GO:0007005 "mitochondrion organization" evidence=TAS
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005759 "mitochondrial matrix" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA;IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0001744 HSP60 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|O74261 HSP60 "Heat shock protein 60, mitochondrial" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
MGI|MGI:96242 Hspd1 "heat shock protein 1 (chaperonin)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621314 Hspd1 "heat shock protein 1 (chaperonin)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P63039 Hspd1 "60 kDa heat shock protein, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPAC12G12.04 mcp60 "mitochondrial heat shock protein Hsp60/Mcp60" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|D4ABH6 D4ABH6 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUZ9 HSPD1 "60 kDa heat shock protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd03344 520 cd03344, GroEL, GroEL_like type I chaperonin 4e-23
PTZ00114 555 PTZ00114, PTZ00114, Heat shock protein 60; Provisi 4e-21
PRK12849 542 PRK12849, groEL, chaperonin GroEL; Reviewed 9e-20
TIGR02348 524 TIGR02348, GroEL, chaperonin GroL 4e-19
PRK00013 542 PRK00013, groEL, chaperonin GroEL; Reviewed 1e-18
PRK12852 545 PRK12852, groEL, chaperonin GroEL; Reviewed 5e-18
PRK12850 544 PRK12850, groEL, chaperonin GroEL; Reviewed 8e-18
PRK12851 541 PRK12851, groEL, chaperonin GroEL; Reviewed 1e-17
PRK14104 546 PRK14104, PRK14104, chaperonin GroEL; Provisional 8e-16
CHL00093 529 CHL00093, groEL, chaperonin GroEL 4e-12
COG0459 524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 7e-10
cd00309 464 cd00309, chaperonin_type_I_II, chaperonin families 3e-07
PLN03167 600 PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr 5e-05
pfam00118 481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 6e-05
>gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information 
 Score = 92.9 bits (232), Expect = 4e-23
 Identities = 44/117 (37%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 12  NAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIE 71
            A  +  ++++G++ AV++V+E L + ++ + T EEIAQVAT S NGD++IG L+A  +E
Sbjct: 105 AAGANPMDLKRGIEKAVEAVVEELKKLSKPVKTKEEIAQVATISANGDEEIGELIAEAME 164

Query: 72  LVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
            V K +G I + EGK    +L +  G + D GY S  FVT+ +K      + Y+ L 
Sbjct: 165 KVGK-DGVITVEEGKTLETELEVVEGMQFDRGYLSPYFVTDPEKMEVELENPYILLT 220

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520
>gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional Back     alignment and domain information
>gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL Back     alignment and domain information
>gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0356 550 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ 100.0
PLN03167 600 Chaperonin-60 beta subunit; Provisional 99.97
PRK14104 546 chaperonin GroEL; Provisional 99.96
CHL00093 529 groEL chaperonin GroEL 99.96
PRK12852 545 groEL chaperonin GroEL; Reviewed 99.96
PTZ00114 555 Heat shock protein 60; Provisional 99.96
COG0459 524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 99.95
TIGR02348 524 GroEL chaperonin GroL. This family consists of Gro 99.94
PRK00013 542 groEL chaperonin GroEL; Reviewed 99.94
PRK12850 544 groEL chaperonin GroEL; Reviewed 99.94
PRK12851 541 groEL chaperonin GroEL; Reviewed 99.93
PRK12849 542 groEL chaperonin GroEL; Reviewed 99.93
cd03344 520 GroEL GroEL_like type I chaperonin. Chaperonins ar 99.92
TIGR02345 522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 99.81
cd03342 484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 99.81
cd03343 517 cpn60 cpn60 chaperonin family. Chaperonins are inv 99.76
cd03338 515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 99.75
TIGR02347 531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 99.74
TIGR02340 536 chap_CCT_alpha T-complex protein 1, alpha subunit. 99.73
cd00309 464 chaperonin_type_I_II chaperonin families, type I a 99.72
cd03340 522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 99.72
PTZ00212 533 T-complex protein 1 subunit beta; Provisional 99.71
TIGR02339 519 thermosome_arch thermosome, various subunits, arch 99.7
TIGR02341 519 chap_CCT_beta T-complex protein 1, beta subunit. M 99.67
TIGR02346 531 chap_CCT_theta T-complex protein 1, theta subunit. 99.67
cd03339 526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 99.62
cd03335 527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 99.6
cd03336 517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 99.59
TIGR02343 532 chap_CCT_epsi T-complex protein 1, epsilon subunit 99.57
TIGR02342 517 chap_CCT_delta T-complex protein 1, delta subunit. 99.51
cd03337 480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 99.49
TIGR02344 525 chap_CCT_gamma T-complex protein 1, gamma subunit. 99.48
cd03341 472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 99.44
PF00118 485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 99.42
cd03333 209 chaperonin_like chaperonin_like superfamily. Chape 98.82
KOG0359 520 consensus Chaperonin complex component, TCP-1 zeta 96.9
KOG0361 543 consensus Chaperonin complex component, TCP-1 eta 95.43
KOG0364 527 consensus Chaperonin complex component, TCP-1 gamm 93.84
KOG0362 537 consensus Chaperonin complex component, TCP-1 thet 92.12
KOG3083271 consensus Prohibitin [Posttranslational modificati 88.08
KOG0358 534 consensus Chaperonin complex component, TCP-1 delt 82.98
KOG0363 527 consensus Chaperonin complex component, TCP-1 beta 81.02
cd03334 261 Fab1_TCP TCP-1 like domain of the eukaryotic phosp 80.73
>KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-42  Score=302.08  Aligned_cols=130  Identities=35%  Similarity=0.552  Sum_probs=127.6

Q ss_pred             cccccchhhhccCCChHHHHHHHHHHHHHHHHHHhhcccccCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEE
Q 032706            2 CNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIF   81 (135)
Q Consensus         2 ~~eg~~l~~v~aG~nP~~l~rGi~~A~~~v~~~L~~~a~~v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvIt   81 (135)
                      ..||  .+.+++|+||+++||||.+|++.+++.|+++|+||+++++|+|||+||||||.++|++|++||++||+ +|+||
T Consensus       113 ~~eg--~~~v~~G~npv~irrGi~~av~~vv~~L~k~sk~Vtt~eeIaqVAtiSAngD~~ig~li~~a~~kvG~-~GVIt  189 (550)
T KOG0356|consen  113 AKEG--FEKVAKGANPVEIRRGIMLAVDAVVDELKKMSKPVTTPEEIAQVATISANGDKEIGNLISDAMKKVGR-KGVIT  189 (550)
T ss_pred             HHHH--HHHHhccCCchhhhhhHHHHHHHHHHHHHHhCCCCCCHHHHHHHHhhhcCCcHHHHHHHHHHHHHhCc-CCeEE
Confidence            4678  89999999999999999999999999999999999999999999999999999999999999999999 99999


Q ss_pred             EecCCCCCeEEEEeeeeEecCccccceeeecCCCceEEeeceeEEEecccccC
Q 032706           82 ITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRL  134 (135)
Q Consensus        82 vee~~~~~~~le~~eG~~fd~GYlSpyfvTd~~~~~~~l~~p~ILitd~kIs~  134 (135)
                      |++|++..++|+++|||+|||||+||||+|+++.+.++|+||++|++|+||++
T Consensus       190 v~~gkt~~delev~eGmkfdrGyiSPyfi~~~k~~~~e~e~~~~ll~~kki~~  242 (550)
T KOG0356|consen  190 VKDGKTLEDELEVIEGMKFDRGYISPYFITSSKKQKVEFENALLLLSEKKISS  242 (550)
T ss_pred             eecCCccccchhhhhcccccccccCccccccchhhhhhhhhhhhhhhhhhhhH
Confidence            99999999999999999999999999999999999999999999999999985

>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>cd03333 chaperonin_like chaperonin_like superfamily Back     alignment and domain information
>KOG0359 consensus Chaperonin complex component, TCP-1 zeta subunit (CCT6) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0361 consensus Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0364 consensus Chaperonin complex component, TCP-1 gamma subunit (CCT3) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0362 consensus Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3083 consensus Prohibitin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0358 consensus Chaperonin complex component, TCP-1 delta subunit (CCT4) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0363 consensus Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1iok_A 545 Crystal Structure Of Chaperonin-60 From Paracoccus 9e-11
3rtk_A 546 Crystal Structure Of Cpn60.2 From Mycobacterium Tub 2e-10
1sjp_A 504 Mycobacterium Tuberculosis Chaperonin60.2 Length = 2e-10
1we3_A 543 Crystal Structure Of The Chaperonin Complex Cpn60CP 1e-08
2yey_A 524 Crystal Structure Of The Allosteric-Defective Chape 5e-08
2eu1_A 548 Crystal Structure Of The Chaperonin Groel-E461k Len 5e-08
1j4z_A 547 Structural And Mechanistic Basis For Allostery In T 5e-08
4aaq_A 548 Atp-Triggered Molecular Mechanics Of The Chaperonin 5e-08
1pcq_A 524 Crystal Structure Of Groel-Groes Length = 524 5e-08
1aon_A 547 Crystal Structure Of The Asymmetric Chaperonin Comp 5e-08
3c9v_A 526 C7 Symmetrized Structure Of Unliganded Groel At 4.7 5e-08
1ss8_A 524 Groel Length = 524 1e-07
1grl_A 548 The Crystal Structure Of The Bacterial Chaperonin G 1e-07
1oel_A 547 Conformational Variability In The Refined Structure 1e-07
1kp8_A 547 Structural Basis For Groel-Assisted Protein Folding 1e-07
1sx3_A 525 Groel14-(Atpgammas)14 Length = 525 1e-07
3cau_A 526 D7 Symmetrized Structure Of Unliganded Groel At 4.2 1e-07
1gr5_A 547 Solution Structure Of Apo Groel By Cryo-Electron Mi 1e-07
>pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 63/116 (54%), Gaps = 1/116 (0%)
Query: 13  AELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIEL 72
           A ++  ++++G+ +A   V+E +  +A+ ++ S E+AQV T S NG+  IG  +A  ++ 
Sbjct: 109 AGMNPMDLKRGIDVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQR 168
Query: 73  VRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
           V   EG I + E K    ++ +  G + D GY S  FVTN  K +      Y+ L+
Sbjct: 169 VGN-EGVITVEENKGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLH 223
>pdb|3RTK|A Chain A, Crystal Structure Of Cpn60.2 From Mycobacterium Tuberculosis At 2.8a Length = 546 Back     alignment and structure
>pdb|1SJP|A Chain A, Mycobacterium Tuberculosis Chaperonin60.2 Length = 504 Back     alignment and structure
>pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 Back     alignment and structure
>pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin Groel E434k Mutant Length = 524 Back     alignment and structure
>pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 Back     alignment and structure
>pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 Back     alignment and structure
>pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel Length = 548 Back     alignment and structure
>pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 Back     alignment and structure
>pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 Back     alignment and structure
>pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 Back     alignment and structure
>pdb|1SS8|A Chain A, Groel Length = 524 Back     alignment and structure
>pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 Back     alignment and structure
>pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 Back     alignment and structure
>pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 Back     alignment and structure
>pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 Back     alignment and structure
>pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 Back     alignment and structure
>pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1iok_A 545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 3e-20
1kp8_A 547 Groel protein; chaperonin, assisted protein foldin 2e-19
3rtk_A 546 60 kDa chaperonin 2; heat shock protein, chaperone 3e-17
1we3_A 543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 3e-17
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 Back     alignment and structure
 Score = 84.2 bits (209), Expect = 3e-20
 Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 19  EIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEG 78
           ++++G+ +A   V+E +  +A+ ++ S E+AQV T S NG+  IG  +A  ++ V   EG
Sbjct: 115 DLKRGIDVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGN-EG 173

Query: 79  HIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLY 128
            I + E K    ++ +  G + D GY S  FVTN  K +      Y+ L+
Sbjct: 174 VITVEENKGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELEDAYILLH 223
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1kp8_A 547 Groel protein; chaperonin, assisted protein foldin 100.0
3rtk_A 546 60 kDa chaperonin 2; heat shock protein, chaperone 100.0
1iok_A 545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 100.0
1we3_A 543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 100.0
3iyg_H 515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 99.93
3p9d_G 550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 99.93
3p9d_D 528 T-complex protein 1 subunit delta; HSP60, eukaryot 99.91
3ruv_A 543 Chaperonin, CPN; double-ring, protein folding mach 99.91
3ko1_A 553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 99.91
3p9d_B 527 T-complex protein 1 subunit beta; HSP60, eukaryoti 99.91
1a6d_A 545 Thermosome (alpha subunit); group II chaperonin, C 99.9
3iyg_E 515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 99.9
1q3q_A 548 Thermosome alpha subunit; chaperone, chaperonin; H 99.89
3aq1_B 500 Thermosome subunit; group II chaperonin, protein f 99.89
1a6d_B 543 Thermosome (beta subunit); group II chaperonin, CC 99.89
3iyg_Q 512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 99.89
3iyg_Z 517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 99.89
3iyg_B 513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 99.88
3p9d_A 559 T-complex protein 1 subunit alpha; HSP60, eukaryot 99.88
3iyg_D 518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 99.88
3m6c_A 194 60 kDa chaperonin 1; chaperone, ATP-binding, nucle 99.88
3iyg_A 529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 99.87
3p9d_E 562 T-complex protein 1 subunit epsilon; HSP60, eukary 99.86
3p9d_C 590 T-complex protein 1 subunit gamma; HSP60, eukaryot 99.83
3osx_A 201 60 kDa chaperonin; alpha, beta, apical domain, cha 99.83
3p9d_F 546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 99.82
3iyg_G 515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 99.81
3p9d_H 568 T-complex protein 1 subunit theta; HSP60, eukaryot 99.76
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure
Probab=100.00  E-value=1.3e-34  Score=253.51  Aligned_cols=130  Identities=28%  Similarity=0.445  Sum_probs=126.9

Q ss_pred             cccccchhhhccCCChHHHHHHHHHHHHHHHHHHhhcccccCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEE
Q 032706            2 CNEGRNLLLENAELDDTEIRKGVQMAVDSVLENLSRSAQMISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIF   81 (135)
Q Consensus         2 ~~eg~~l~~v~aG~nP~~l~rGi~~A~~~v~~~L~~~a~~v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvIt   81 (135)
                      ++||  ++++++|+||+.|++|+++|++.+++.|+++|+||++.++|.+||++|+|+|+.+|+|+++||.+||+ +|+|+
T Consensus        99 l~ea--~~lv~~GihP~~I~~G~~~A~~~a~~~L~~~s~~v~~~e~l~~vA~iS~~~~~~i~~liadAv~~V~~-dg~I~  175 (547)
T 1kp8_A           99 ITEG--LKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGK-EGVIT  175 (547)
T ss_dssp             HHHH--HHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHCBCCCSHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCT-TSEEE
T ss_pred             HHHH--HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHhCcCCCCHHHHHHHHHHhccchhHHHHHHHHHHHHhCc-CCcEE
Confidence            5678  89999999999999999999999999999999999999999999999999899999999999999999 99999


Q ss_pred             EecCCCCCeEEEEeeeeEecCccccceeeecCCCceEEeeceeEEEecccccC
Q 032706           82 ITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNKKKKLCFQSSTYLFLYGETFRL  134 (135)
Q Consensus        82 vee~~~~~~~le~~eG~~fd~GYlSpyfvTd~~~~~~~l~~p~ILitd~kIs~  134 (135)
                      |++|+++++++++++||+||+||+||||+|++++|.++++|||||++|.+|++
T Consensus       176 Ve~G~~~~ds~~lveG~~fdkg~~~p~~vt~~~~m~~~lenp~Ill~d~~Is~  228 (547)
T 1kp8_A          176 VEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISN  228 (547)
T ss_dssp             EECCSSSSCEEEEESCEEESCCBSSTTCCSBTTTTBEEEESCEEECEESEECC
T ss_pred             EEeCCccccccEEEecEEEecCccccccccCcccCceEecCceEEEEcCcCCC
Confidence            99999999999999999999999999999999999999999999999999986
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3m6c_A 60 kDa chaperonin 1; chaperone, ATP-binding, nucleotide-binding; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>3osx_A 60 kDa chaperonin; alpha, beta, apical domain, chaperone; 1.55A {Xenorhabdus nematophila} SCOP: c.8.5.1 PDB: 1kid_A 1fy9_A 1la1_A 1fya_A 1jon_A 1dk7_A 1dkd_A Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1sjpa389 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {My 2e-13
d1kp8a397 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Es 9e-10
d1ioka397 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Pa 5e-09
d1we3a386 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Th 1e-06
>d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 89 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: GroEL-intermediate domain like
superfamily: GroEL-intermediate domain like
family: GroEL-like chaperone, intermediate domain
domain: GroEL, I domain
species: Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]

 Score = 59.4 bits (144), Expect = 2e-13
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 42  ISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLD 101
           + T E+IA  A  S  GD+ IG L+A  ++ V   EG I + E    G++L L     + 
Sbjct: 2   VETKEQIAATAAIS-AGDQSIGDLIAEAMDKVGN-EGVITVEESNTFGLQLELTEVAVIK 59

Query: 102 WGYSSSCFVTNKKKKL 117
            G ++   +  +K ++
Sbjct: 60  AGAATEVELKERKHRI 75
>d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Length = 97 Back     information, alignment and structure
>d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1sjpa389 GroEL, I domain {Mycobacterium tuberculosis, GroEL 100.0
d1kp8a397 GroEL, I domain {Escherichia coli [TaxId: 562]} 99.97
d1we3a386 GroEL, I domain {Thermus thermophilus [TaxId: 274] 99.97
d1ioka397 GroEL, I domain {Paracoccus denitrificans [TaxId: 99.97
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 99.89
d1ioka1252 GroEL, E domain {Paracoccus denitrificans [TaxId: 99.79
d1we3a1255 GroEL, E domain {Thermus thermophilus [TaxId: 274] 99.77
d1kida_ 193 GroEL, A domain {Escherichia coli [TaxId: 562]} 99.76
d1q3qa1258 Thermosome, E domain {Archaeon Thermococcus sp. ks 99.68
d1sjpa1180 GroEL, E domain {Mycobacterium tuberculosis, GroEL 98.52
d1a6da1245 Thermosome, E domain {Archaeon Thermoplasma acidop 98.11
d1a6db1243 Thermosome, E domain {Archaeon Thermoplasma acidop 97.52
>d1sjpa3 d.56.1.1 (A:135-188,A:373-407) GroEL, I domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: GroEL-intermediate domain like
superfamily: GroEL-intermediate domain like
family: GroEL-like chaperone, intermediate domain
domain: GroEL, I domain
species: Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]

Probab=100.00  E-value=1.2e-38  Score=220.32  Aligned_cols=86  Identities=24%  Similarity=0.308  Sum_probs=83.0

Q ss_pred             cCCHHHHHHHHhhccCCChhhhHHHHHHHHHhccCCceEEEecCCCCCeEEEEeeeeEecCccccceeeecC-CCceEEe
Q 032706           42 ISTSEEIAQVATTSINGDKDIGALVARTIELVRKAEGHIFITEGKEPGVKLNLYSGFKLDWGYSSSCFVTNK-KKKLCFQ  120 (135)
Q Consensus        42 v~~~~~i~~VAtisan~D~~iG~liaeA~~kVG~~dGvItvee~~~~~~~le~~eG~~fd~GYlSpyfvTd~-~~~~~~l  120 (135)
                      |+++++|+||||||| ||+.||++||+||++||+ +|+||+|+|++.++++++++||+||+||+||||+||+ +|++++|
T Consensus         2 V~~~e~i~~VAtISa-~D~~iG~lIa~A~~kVG~-dGvItvEe~~~~~t~le~veG~~~d~Gy~Sp~fvtd~k~r~e~~l   79 (89)
T d1sjpa3           2 VETKEQIAATAAISA-GDQSIGDLIAEAMDKVGN-EGVITVEESNTFGLQLELTEVAVIKAGAATEVELKERKHRIEDAV   79 (89)
T ss_dssp             CCSHHHHHHHHHHHT-TCHHHHHHHHHHHHHSCT-TSCEEEEEESSSSEEEEEESEEEEEEECSSHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHhhheec-CCHHHHHHHHHHHHhcCC-CCceEEEeccccceEEEEEEEEEecCCccCceEEcccHHhhHHHH
Confidence            688999999999999 699999999999999999 9999999999999999999999999999999999985 7889999


Q ss_pred             eceeEEEec
Q 032706          121 SSTYLFLYG  129 (135)
Q Consensus       121 ~~p~ILitd  129 (135)
                      +||||||+|
T Consensus        80 ~~p~ili~d   88 (89)
T d1sjpa3          80 RNAKAAVEE   88 (89)
T ss_dssp             HHHHHHHHH
T ss_pred             hCceEeeec
Confidence            999999987
>d1kp8a3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we3a3 d.56.1.1 (A:139-189,A:374-408) GroEL, I domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ioka3 d.56.1.1 (A:137-190,A:367-409) GroEL, I domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kida_ c.8.5.1 (A:) GroEL, A domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure