Citrus Sinensis ID: 032711


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSRETVEGLGNALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPHHFIMQS
cccHHccccccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccc
cccHHHHHHHHHHHccccccccccccHHHHcccccccccHcHHHHHHHHHHHHHccccccccccccEEEEEccccccccccccccHHHHHHHHHHHcccHcccccHHHHHccHHHHccccccccccHHHHHHHcc
MSRETVEGLGNALRRKWHVSRWNSLTDQvvnsknggyglpadiwSVGCTVLEmltrcrpyfGVEWVQALFKIArgelppipdsvsrDARDFILKCLqvnpndrptaaqlmehpfvkrplptswglptphhfimqs
msretveglgnalrrkwhvsrwNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARgelppipdsVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKrplptswglptphhfimqs
MSRETVEGLGNALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPHHFIMQS
*********GNALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVN**************FV*******WG***********
***ET*E*********WHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPF*********************
**********NALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPHHFIMQS
*****VEGLGNALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPHHFIMQS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRETVEGLGNALRRKWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPHHFIMQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q39008608 Mitogen-activated protein yes no 0.688 0.152 0.659 2e-30
Q9SZ671895 Probable WRKY transcripti no no 0.770 0.054 0.584 2e-28
Q9FZ36 651 Mitogen-activated protein no no 0.592 0.122 0.536 1e-18
O22040 666 Mitogen-activated protein no no 0.592 0.120 0.548 5e-18
Q54XJ4 1495 Probable serine/threonine yes no 0.6 0.054 0.444 5e-17
Q9Y6R41608 Mitogen-activated protein yes no 0.651 0.054 0.438 2e-16
Q56UN51328 Mitogen-activated protein no no 0.674 0.068 0.421 5e-16
Q013891478 Serine/threonine-protein yes no 0.659 0.060 0.421 1e-15
Q104071116 MAP kinase kinase kinase yes no 0.681 0.082 0.412 1e-15
O086481597 Mitogen-activated protein yes no 0.651 0.055 0.426 1e-15
>sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 Back     alignment and function desciption
 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 76/94 (80%), Gaps = 1/94 (1%)

Query: 28  QVVNSKNG-GYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSR 86
           +V+N K+  GYG PADIWS+GCTVLEM T   PY  +E VQALF+I RG LP +PD++S 
Sbjct: 499 EVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSL 558

Query: 87  DARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLP 120
           DAR FILKCL+VNP +RPTAA+L+ HPFV+RPLP
Sbjct: 559 DARLFILKCLKVNPEERPTAAELLNHPFVRRPLP 592




Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MEK1/MKK2 and MPK4/MPK6). Activates downstream MKK2, MKK4 and MKK5.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 5
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 Back     alignment and function description
>sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 Back     alignment and function description
>sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 Back     alignment and function description
>sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 Back     alignment and function description
>sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 Back     alignment and function description
>sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 Back     alignment and function description
>sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
356509460 566 PREDICTED: mitogen-activated protein kin 0.755 0.180 0.696 6e-36
224082218 548 predicted protein [Populus trichocarpa] 0.755 0.186 0.705 7e-36
255545546 555 Mitogen-activated protein kinase kinase 0.762 0.185 0.679 3e-35
224066881 558 predicted protein [Populus trichocarpa] 0.755 0.182 0.686 4e-35
302141878 273 unnamed protein product [Vitis vinifera] 0.748 0.369 0.702 3e-34
225459451 567 PREDICTED: mitogen-activated protein kin 0.748 0.178 0.702 4e-34
356518515 555 PREDICTED: mitogen-activated protein kin 0.755 0.183 0.666 2e-33
359486016 559 PREDICTED: mitogen-activated protein kin 0.748 0.180 0.673 3e-33
356557517 440 PREDICTED: mitogen-activated protein kin 0.681 0.209 0.728 4e-33
298204644 719 unnamed protein product [Vitis vinifera] 0.748 0.140 0.673 5e-33
>gi|356509460|ref|XP_003523467.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 83/102 (81%)

Query: 28  QVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRD 87
           +VV  KN GYGLPAD+WS+GCTVLEMLT   PY  +E +QALF+I +GE PPIPDS+SRD
Sbjct: 459 EVVKGKNKGYGLPADMWSLGCTVLEMLTGQLPYRDLECMQALFRIGKGERPPIPDSLSRD 518

Query: 88  ARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTSWGLPTPH 129
           A+DFIL+CLQVNPNDRPTAAQL+ H FV+RPL  S G   PH
Sbjct: 519 AQDFILQCLQVNPNDRPTAAQLLNHSFVQRPLSQSSGSSFPH 560




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224082218|ref|XP_002306607.1| predicted protein [Populus trichocarpa] gi|222856056|gb|EEE93603.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545546|ref|XP_002513833.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus communis] gi|223546919|gb|EEF48416.1| Mitogen-activated protein kinase kinase kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224066881|ref|XP_002302260.1| predicted protein [Populus trichocarpa] gi|222843986|gb|EEE81533.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302141878|emb|CBI19081.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459451|ref|XP_002284356.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356518515|ref|XP_003527924.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359486016|ref|XP_002264549.2| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356557517|ref|XP_003547062.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|298204644|emb|CBI23919.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2133559608 MEKK1 "MAPK/ERK kinase kinase 0.718 0.159 0.632 4.9e-29
TAIR|locus:2133539773 MAPKKK9 "mitogen-activated pro 0.814 0.142 0.548 5.6e-28
TAIR|locus:21181161895 WRKY19 [Arabidopsis thaliana ( 0.785 0.055 0.583 1.5e-27
TAIR|locus:2133529560 MEKK3 "MAPK/ERK kinase kinase 0.674 0.162 0.586 3.1e-24
TAIR|locus:2026674 883 YDA "YODA" [Arabidopsis thalia 0.703 0.107 0.505 3.9e-20
TAIR|locus:2024832 609 MAP3KA "mitogen-activated prot 0.674 0.149 0.516 8e-19
TAIR|locus:2035989 666 NP1 "NPK1-related protein kina 0.592 0.120 0.548 3.1e-17
UNIPROTKB|E1BXN61565 MAP3K4 "Uncharacterized protei 0.651 0.056 0.460 4e-17
UNIPROTKB|F1SB84297 LOC100518100 "Uncharacterized 0.651 0.296 0.426 4.1e-17
UNIPROTKB|I3LSD0114 LOC100518100 "Uncharacterized 0.651 0.771 0.426 4.1e-17
TAIR|locus:2133559 MEKK1 "MAPK/ERK kinase kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 329 (120.9 bits), Expect = 4.9e-29, P = 4.9e-29
 Identities = 62/98 (63%), Positives = 78/98 (79%)

Query:    25 LTDQVVNSKNG-GYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDS 83
             +  +V+N K+  GYG PADIWS+GCTVLEM T   PY  +E VQALF+I RG LP +PD+
Sbjct:   496 MAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDT 555

Query:    84 VSRDARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPT 121
             +S DAR FILKCL+VNP +RPTAA+L+ HPFV+RPLP+
Sbjct:   556 LSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPS 593




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IGI
GO:0006970 "response to osmotic stress" evidence=IGI;IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0004709 "MAP kinase kinase kinase activity" evidence=ISS;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009611 "response to wounding" evidence=RCA;IDA
GO:0003677 "DNA binding" evidence=IDA
GO:0019900 "kinase binding" evidence=IPI
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0000165 "MAPK cascade" evidence=IMP;RCA;IPI
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0007154 "cell communication" evidence=RCA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0009556 "microsporogenesis" evidence=RCA
GO:0009620 "response to fungus" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0052543 "callose deposition in cell wall" evidence=RCA
TAIR|locus:2133539 MAPKKK9 "mitogen-activated protein kinase kinase kinase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133529 MEKK3 "MAPK/ERK kinase kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026674 YDA "YODA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024832 MAP3KA "mitogen-activated protein kinase kinase kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035989 NP1 "NPK1-related protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXN6 MAP3K4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB84 LOC100518100 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSD0 LOC100518100 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-42
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-37
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-29
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-28
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 8e-28
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-27
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 7e-25
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 7e-25
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-24
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 7e-24
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-23
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-23
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 8e-23
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-21
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 3e-21
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 9e-21
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 3e-20
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 9e-20
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-19
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 5e-19
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 7e-19
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-18
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 1e-18
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 4e-17
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 9e-17
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 9e-17
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-16
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-16
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 5e-16
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 7e-16
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 2e-15
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-15
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-15
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 3e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-14
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 2e-14
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-14
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 5e-14
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 5e-14
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 6e-14
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 8e-14
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-13
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-13
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-13
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-13
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-13
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-13
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-13
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-13
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-13
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 4e-13
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 4e-13
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 5e-13
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 6e-13
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 6e-13
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-12
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-12
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-12
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-12
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-12
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-12
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 4e-12
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 4e-12
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-12
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-11
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-11
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-11
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 2e-11
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-11
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-11
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 3e-11
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-11
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-11
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 4e-11
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 5e-11
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 6e-11
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 8e-11
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-10
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-10
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-10
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 4e-10
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 4e-10
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 4e-10
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 6e-10
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 8e-10
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-09
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-09
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-09
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 4e-09
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 5e-09
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 7e-09
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 8e-09
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-08
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-08
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-08
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 3e-08
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 3e-08
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 3e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 4e-08
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 5e-08
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-08
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 8e-08
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 9e-08
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 9e-08
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 9e-08
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 3e-07
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 4e-07
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 6e-07
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 7e-07
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-06
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-06
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-06
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 2e-06
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-06
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 3e-06
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 3e-06
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 3e-06
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 4e-06
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 5e-06
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 6e-06
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 6e-06
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-06
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 8e-06
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-05
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-05
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 1e-05
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 1e-05
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-05
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-05
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-05
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 2e-05
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-05
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-05
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-05
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-05
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-05
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 4e-05
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 5e-05
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 5e-05
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 5e-05
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 6e-05
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 7e-05
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 7e-05
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 8e-05
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 9e-05
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 1e-04
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-04
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 1e-04
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-04
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-04
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 2e-04
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-04
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-04
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-04
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 3e-04
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-04
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-04
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 3e-04
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 4e-04
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 4e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 4e-04
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 5e-04
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 5e-04
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 6e-04
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 6e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 6e-04
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 6e-04
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 8e-04
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 0.001
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 0.001
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 0.001
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.001
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 0.002
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 0.002
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 0.002
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.002
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 0.002
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 0.002
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.002
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 0.002
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 0.002
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 0.002
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 0.003
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.004
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 0.004
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.004
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.004
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
 Score =  139 bits (351), Expect = 6e-42
 Identities = 56/89 (62%), Positives = 70/89 (78%), Gaps = 2/89 (2%)

Query: 28  QVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIAR-GELPPIPDSVSR 86
           +V+  + GGYGL ADIWS+GCTVLEM T   P+  +E V A+FKI R  ELPPIPD +S 
Sbjct: 171 EVIAQQ-GGYGLAADIWSLGCTVLEMATGKPPWSQLEGVAAVFKIGRSKELPPIPDHLSD 229

Query: 87  DARDFILKCLQVNPNDRPTAAQLMEHPFV 115
           +A+DFILKCLQ +P+ RPTAA+L+EHPFV
Sbjct: 230 EAKDFILKCLQRDPSLRPTAAELLEHPFV 258


Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidopsis thaliana MEKK1 activates MPK4, a MAPK that regulates systemic acquired resistance. MEKK1 also participates in the regulation of temperature-sensitive and tissue-specific cell death. Length = 258

>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.92
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.92
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.92
KOG0578550 consensus p21-activated serine/threonine protein k 99.91
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.91
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.91
KOG0605550 consensus NDR and related serine/threonine kinases 99.89
KOG0610459 consensus Putative serine/threonine protein kinase 99.89
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.89
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.88
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.88
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.87
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.87
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.86
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.86
PTZ00284467 protein kinase; Provisional 99.86
KOG0198313 consensus MEKK and related serine/threonine protei 99.85
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.85
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.84
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.84
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.84
PTZ00036440 glycogen synthase kinase; Provisional 99.83
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.83
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.83
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.82
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.82
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.82
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.82
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.82
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.82
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.81
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.81
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.81
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.81
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.81
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.81
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.81
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.81
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.81
PTZ00283 496 serine/threonine protein kinase; Provisional 99.81
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.8
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.8
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.8
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.8
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.8
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.8
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.8
KOG0589 426 consensus Serine/threonine protein kinase [General 99.8
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.8
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.8
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.8
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.8
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.8
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.8
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.8
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.79
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.79
PTZ00267 478 NIMA-related protein kinase; Provisional 99.79
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.79
KOG0596677 consensus Dual specificity; serine/threonine and t 99.79
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.79
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.79
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.79
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.79
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.79
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.79
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.79
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.79
PHA02988283 hypothetical protein; Provisional 99.79
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.79
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.79
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.79
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.79
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.78
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.78
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.78
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.78
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.78
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.78
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.78
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.78
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.78
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.78
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.78
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.77
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.77
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.77
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.77
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.77
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.77
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.77
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.77
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.77
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.77
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.77
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.77
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.77
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.77
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.76
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.76
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.76
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.76
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.76
KOG0584 632 consensus Serine/threonine protein kinase [General 99.76
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.76
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.76
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.76
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.76
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.76
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.76
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.76
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.76
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.76
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.76
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.76
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.76
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.76
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.76
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.75
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.75
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.75
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.75
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.75
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.75
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.75
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.75
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.75
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.75
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.75
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.75
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.75
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.75
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.75
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.75
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.75
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.75
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.75
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.75
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.75
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.74
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.74
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.74
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.74
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.74
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.74
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.74
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.74
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.74
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.74
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.74
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.74
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.74
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.74
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.74
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.73
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.73
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.73
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.73
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.73
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.73
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.73
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.73
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.73
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.73
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.73
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.73
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.73
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.73
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.73
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.73
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.73
PHA03212391 serine/threonine kinase US3; Provisional 99.73
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.73
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.72
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.72
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.72
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.72
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.72
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.72
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.72
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.72
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.72
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.72
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.72
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.72
PHA03207392 serine/threonine kinase US3; Provisional 99.72
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.72
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.72
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.72
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.72
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.72
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.72
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.72
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.72
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.72
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.72
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.71
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.71
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.71
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.71
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.71
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.71
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.71
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.71
PHA03211461 serine/threonine kinase US3; Provisional 99.71
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.71
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.71
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.71
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.71
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.71
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.71
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.71
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.71
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.71
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.71
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.7
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.7
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.7
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.7
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.7
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.7
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.7
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.7
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.7
PLN00009294 cyclin-dependent kinase A; Provisional 99.7
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.7
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.7
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.7
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.7
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.7
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.7
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.7
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.69
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.69
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.69
PHA03209357 serine/threonine kinase US3; Provisional 99.69
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.69
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.69
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.69
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.69
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.69
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.69
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.69
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.69
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.69
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.69
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.69
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.69
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.69
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.69
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.68
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.68
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.68
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.68
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.68
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.68
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.68
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.68
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.68
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.68
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.68
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.68
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.68
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.68
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.68
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.68
PLN00181 793 protein SPA1-RELATED; Provisional 99.68
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.68
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.68
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.68
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.67
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.67
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.67
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.67
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.66
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.66
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.66
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.66
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.66
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.66
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.66
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.66
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.66
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.66
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.66
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.66
PHA03210501 serine/threonine kinase US3; Provisional 99.66
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.65
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.65
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.65
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.65
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.65
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.65
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.65
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.65
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.65
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.65
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.65
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.65
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.64
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.64
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.64
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.64
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.64
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.64
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.64
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.63
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.63
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.63
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.63
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.63
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.63
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.63
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.63
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.63
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.63
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.63
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.63
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.63
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.63
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.62
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.62
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.62
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.62
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.62
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.62
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.62
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.62
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.62
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.62
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.61
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.61
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.61
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.61
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.61
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.61
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.6
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.6
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.6
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.6
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.6
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.59
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.59
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.59
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.59
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.59
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.59
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.58
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.58
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.58
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.58
PHA02882294 putative serine/threonine kinase; Provisional 99.58
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.58
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.57
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.57
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.57
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.56
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.56
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.55
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.55
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.55
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.54
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.54
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.54
KOG0586 596 consensus Serine/threonine protein kinase [General 99.54
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.54
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.53
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.53
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.53
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.53
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.53
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.53
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.52
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.52
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.52
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.52
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.52
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.51
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.5
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.5
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.49
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.48
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.47
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.46
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.45
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.43
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.42
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.4
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.39
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.39
KOG1167418 consensus Serine/threonine protein kinase of the C 99.37
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.36
PLN03224507 probable serine/threonine protein kinase; Provisio 99.33
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.28
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.27
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.24
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.21
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.19
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.17
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.1
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.09
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 98.97
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 98.9
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 98.86
KOG3653534 consensus Transforming growth factor beta/activin 98.76
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 98.74
KOG06061205 consensus Microtubule-associated serine/threonine 98.68
KOG2052513 consensus Activin A type IB receptor, serine/threo 98.61
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.59
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.56
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.43
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.3
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.22
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 98.14
KOG1345378 consensus Serine/threonine kinase [Signal transduc 98.02
KOG0590 601 consensus Checkpoint kinase and related serine/thr 97.97
KOG1152772 consensus Signal transduction serine/threonine kin 97.85
KOG1266 458 consensus Protein kinase [Signal transduction mech 97.33
KOG2137 700 consensus Protein kinase [Signal transduction mech 97.26
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 96.04
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 95.79
KOG1093 725 consensus Predicted protein kinase (contains TBC a 93.4
COG4248 637 Uncharacterized protein with protein kinase and he 87.17
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 82.44
KOG0576 829 consensus Mitogen-activated protein kinase kinase 80.49
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=99.92  E-value=1.7e-25  Score=157.65  Aligned_cols=109  Identities=30%  Similarity=0.545  Sum_probs=97.6

Q ss_pred             hhhhhhhhhhh-------hcccccccccchhhhhccCCCCCchhhHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHcCCC
Q 032711            5 TVEGLGNALRR-------KWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGEL   77 (135)
Q Consensus         5 ~~~~~~~~~~~-------~~~~gt~~~~aPE~~~~~~~~~~~~~dvws~G~~l~~l~~g~~p~~~~~~~~~~~~i~~~~~   77 (135)
                      +|+|+|.+...       .+.|||+.|+|||++...  +++..+||||+||++|.|+.|++||...+-.+.+.+|....+
T Consensus       158 KIgDFGLAt~le~~~Erk~TlCGTPNYIAPEVl~k~--gHsfEvDiWSlGcvmYtLL~G~PPFetk~vkety~~Ik~~~Y  235 (592)
T KOG0575|consen  158 KIGDFGLATQLEYDGERKKTLCGTPNYIAPEVLNKS--GHSFEVDIWSLGCVMYTLLVGRPPFETKTVKETYNKIKLNEY  235 (592)
T ss_pred             EecccceeeeecCcccccceecCCCcccChhHhccC--CCCCchhhhhhhhHHHhhhhCCCCcccchHHHHHHHHHhcCc
Confidence            36677765544       368999999999999865  789999999999999999999999999998999999887777


Q ss_pred             CCCCCcccHHHHHHHHHhcccCCCCCCCHHHHhhCcCCC
Q 032711           78 PPIPDSVSRDARDFILKCLQVNPNDRPTAAQLMEHPFVK  116 (135)
Q Consensus        78 ~~~~~~~~~~~~~li~~~l~~~p~~Rps~~~~l~~~~~~  116 (135)
                       ..|..++.++++||.++|..+|.+||++++++.|+||.
T Consensus       236 -~~P~~ls~~A~dLI~~lL~~~P~~Rpsl~~vL~h~Ff~  273 (592)
T KOG0575|consen  236 -SMPSHLSAEAKDLIRKLLRPNPSERPSLDEVLDHPFFK  273 (592)
T ss_pred             -ccccccCHHHHHHHHHHhcCCcccCCCHHHHhcCHhhh
Confidence             67779999999999999999999999999999999994



>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 6e-14
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 7e-14
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 4e-12
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 5e-12
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 1e-11
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 1e-11
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-11
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-11
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-11
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-11
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 1e-10
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 3e-10
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 4e-10
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-10
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 6e-10
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 6e-10
3a7f_A303 Human Mst3 Kinase Length = 303 1e-09
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-09
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-09
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-09
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-09
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 4e-09
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 6e-09
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 6e-09
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 7e-09
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 8e-09
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 9e-09
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 9e-09
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 9e-09
4fie_A423 Full-Length Human Pak4 Length = 423 9e-09
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 9e-09
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-08
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-08
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-08
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-08
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-08
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-08
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-08
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 7e-08
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 8e-08
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 8e-08
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-07
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-07
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 1e-07
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-07
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-07
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-07
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 2e-07
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-07
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-07
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-07
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-07
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-07
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-07
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-07
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-07
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-07
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-07
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 2e-07
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-07
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-07
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-07
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-07
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-07
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-07
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-07
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-07
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-07
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-07
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 2e-07
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-07
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-07
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 2e-07
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-07
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-07
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-07
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-07
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 3e-07
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 4e-07
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 4e-07
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 4e-07
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 4e-07
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 7e-07
3soa_A 444 Full-Length Human Camkii Length = 444 1e-06
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 2e-06
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 2e-06
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 2e-06
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 2e-06
4exu_A371 Mapk13, Inactive Form Length = 371 2e-06
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 2e-06
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-06
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 3e-06
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 4e-06
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-06
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-06
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-06
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 4e-06
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-06
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 4e-06
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 5e-06
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 5e-06
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 6e-06
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 6e-06
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 6e-06
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 6e-06
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 7e-06
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 7e-06
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 8e-06
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 8e-06
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-06
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 8e-06
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 8e-06
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 9e-06
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-05
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-05
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-05
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 1e-05
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 1e-05
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-05
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-05
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-05
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-05
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-05
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-05
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-05
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-05
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 1e-05
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 1e-05
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 1e-05
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 1e-05
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-05
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 1e-05
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-05
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-05
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-05
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-05
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-05
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-05
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-05
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 1e-05
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 1e-05
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-05
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-05
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-05
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-05
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-05
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-05
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-05
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-05
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-05
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-05
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 2e-05
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-05
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-05
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 2e-05
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 2e-05
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 2e-05
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 2e-05
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 2e-05
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 2e-05
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 2e-05
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 2e-05
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 2e-05
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 2e-05
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 2e-05
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 2e-05
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 2e-05
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 2e-05
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 2e-05
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-05
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-05
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 2e-05
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 2e-05
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-05
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-05
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-05
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-05
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 3e-05
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-05
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 3e-05
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 3e-05
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-05
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 3e-05
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 3e-05
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 3e-05
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 4e-05
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 4e-05
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 4e-05
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-05
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 4e-05
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 4e-05
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 4e-05
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 4e-05
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 4e-05
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 4e-05
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-05
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 4e-05
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 4e-05
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 4e-05
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 4e-05
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 5e-05
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 5e-05
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 5e-05
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 5e-05
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-05
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 5e-05
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 5e-05
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-05
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-05
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 5e-05
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-05
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 5e-05
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-05
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 5e-05
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-05
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-05
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-05
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 5e-05
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-05
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 5e-05
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 6e-05
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 6e-05
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 6e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 6e-05
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 6e-05
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 7e-05
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 7e-05
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 7e-05
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 8e-05
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 8e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 8e-05
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 8e-05
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 8e-05
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 8e-05
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 8e-05
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 8e-05
3gni_B389 Structure Of Strad And Mo25 Length = 389 1e-04
2wtk_B373 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-04
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-04
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-04
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 2e-04
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-04
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-04
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 2e-04
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-04
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 2e-04
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-04
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-04
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 3e-04
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 3e-04
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 3e-04
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 3e-04
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-04
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-04
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-04
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 3e-04
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 4e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 4e-04
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 4e-04
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 4e-04
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 4e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 4e-04
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-04
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 4e-04
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 4e-04
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 4e-04
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 4e-04
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 4e-04
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 4e-04
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 4e-04
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-04
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-04
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 4e-04
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 4e-04
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-04
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 4e-04
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 4e-04
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 4e-04
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 4e-04
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 4e-04
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 4e-04
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 4e-04
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 4e-04
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 4e-04
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 4e-04
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 4e-04
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 4e-04
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 4e-04
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-04
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 4e-04
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 4e-04
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-04
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 4e-04
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 4e-04
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 4e-04
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 5e-04
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 5e-04
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 5e-04
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 5e-04
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-04
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-04
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-04
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 5e-04
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-04
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 5e-04
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 5e-04
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-04
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 5e-04
1smh_A350 Protein Kinase A Variant Complex With Completely Or 5e-04
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-04
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 5e-04
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-04
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 5e-04
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 5e-04
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 5e-04
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 5e-04
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 5e-04
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-04
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 5e-04
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 5e-04
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 5e-04
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-04
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-04
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-04
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 6e-04
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 6e-04
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 6e-04
4ae6_A343 Structure And Function Of The Human Sperm-specific 6e-04
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 6e-04
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 6e-04
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 6e-04
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 6e-04
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 6e-04
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-04
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 6e-04
4ae9_A343 Structure And Function Of The Human Sperm-specific 6e-04
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 6e-04
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 6e-04
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 6e-04
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 6e-04
2qcs_A350 A Complex Structure Between The Catalytic And Regul 6e-04
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 6e-04
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 6e-04
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 6e-04
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 6e-04
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 7e-04
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 7e-04
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 7e-04
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 7e-04
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 7e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 7e-04
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 7e-04
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 8e-04
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 8e-04
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 8e-04
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 8e-04
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 8e-04
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 9e-04
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 9e-04
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 9e-04
2pl0_A289 Lck Bound To Imatinib Length = 289 9e-04
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 59/91 (64%), Gaps = 2/91 (2%) Query: 28 QVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGV-EWVQALFKIARGEL-PPIPDSVS 85 ++++ GYG ADIWS+GCT++EM T P++ + E A+FK+ ++ P IP+S+S Sbjct: 193 EIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMS 252 Query: 86 RDARDFILKCLQVNPNDRPTAAQLMEHPFVK 116 +A+ FILKC + +P+ R A L+ F+K Sbjct: 253 AEAKAFILKCFEPDPDKRACANDLLVDEFLK 283
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 Back     alignment and structure
>pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-45
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-40
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 4e-36
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-33
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-32
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 8e-32
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 9e-32
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-31
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-31
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-29
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-29
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-27
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-27
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 3e-27
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 4e-27
2a19_B284 Interferon-induced, double-stranded RNA-activated 5e-27
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 5e-27
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-26
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-26
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-26
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 4e-25
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-24
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-24
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-23
3an0_A340 Dual specificity mitogen-activated protein kinase; 4e-23
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-23
3aln_A327 Dual specificity mitogen-activated protein kinase; 5e-23
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-22
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 3e-22
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-21
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 3e-21
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 8e-21
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 3e-20
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 8e-20
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 1e-19
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-19
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-19
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-19
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-19
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-19
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-19
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 3e-19
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 6e-19
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 9e-19
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-18
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 5e-18
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 5e-18
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 8e-18
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-18
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-17
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-17
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 3e-17
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 5e-17
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 6e-17
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 7e-17
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 9e-17
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-16
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-16
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 2e-16
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-16
3bhy_A283 Death-associated protein kinase 3; death associate 3e-16
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-16
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-16
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-16
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 6e-16
2eue_A275 Carbon catabolite derepressing protein kinase; kin 6e-16
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 6e-16
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 7e-16
2y0a_A326 Death-associated protein kinase 1; transferase, ca 8e-16
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 9e-16
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 9e-16
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-15
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-15
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 1e-15
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-15
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-15
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-15
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-15
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-15
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-15
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-15
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 5e-15
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 7e-15
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-15
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-14
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-14
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-14
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-14
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-14
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 4e-14
3dls_A335 PAS domain-containing serine/threonine-protein KI; 6e-14
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 7e-14
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 8e-14
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 8e-14
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-13
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-13
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-13
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-13
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 3e-13
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 3e-13
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-13
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-13
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 4e-13
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-13
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 4e-13
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 5e-13
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 5e-13
2fst_X367 Mitogen-activated protein kinase 14; active mutant 6e-13
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 8e-13
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 9e-13
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 9e-13
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 1e-12
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-12
3niz_A311 Rhodanese family protein; structural genomics, str 2e-12
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-12
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-12
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 3e-12
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-12
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 5e-12
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 5e-12
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 6e-12
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 7e-12
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-12
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-12
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 8e-12
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-11
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 1e-11
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 1e-11
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-11
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-11
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-11
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-11
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-11
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-11
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 3e-11
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-11
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 6e-11
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-11
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-11
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-11
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 1e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-10
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-10
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-10
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-10
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 3e-10
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-10
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 7e-10
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 7e-10
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-09
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-09
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-09
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 3e-09
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 3e-09
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-09
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-09
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 8e-09
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-08
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-08
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-08
3rp9_A458 Mitogen-activated protein kinase; structural genom 4e-08
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 5e-08
3soc_A322 Activin receptor type-2A; structural genomics cons 6e-08
3lzb_A327 Epidermal growth factor receptor; epidermal growth 7e-08
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-08
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 9e-08
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-07
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-07
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-07
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-07
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-07
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-07
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-07
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-07
3uqc_A286 Probable conserved transmembrane protein; structur 2e-07
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-07
4aoj_A329 High affinity nerve growth factor receptor; transf 2e-07
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-07
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-07
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 3e-07
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-07
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-07
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-07
3q4u_A301 Activin receptor type-1; structural genomics conso 4e-07
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 4e-07
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-07
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 5e-07
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 5e-07
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 7e-07
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 7e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-06
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 1e-06
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-06
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-06
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 1e-06
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-06
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-06
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-06
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-06
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-06
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-06
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 4e-06
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-06
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 6e-06
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 6e-06
2xir_A316 Vascular endothelial growth factor receptor 2; ang 6e-06
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 6e-06
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 7e-06
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 9e-06
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-05
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-05
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-05
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 4e-05
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 5e-05
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 6e-05
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 6e-05
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 9e-05
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-04
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
 Score =  148 bits (376), Expect = 1e-45
 Identities = 36/96 (37%), Positives = 58/96 (60%), Gaps = 2/96 (2%)

Query: 29  VVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGV-EWVQALFKIARGEL-PPIPDSVSR 86
           +++    GYG  ADIWS+GCT++EM T   P++ + E   A+FK+   ++ P IP+S+S 
Sbjct: 194 IIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSA 253

Query: 87  DARDFILKCLQVNPNDRPTAAQLMEHPFVKRPLPTS 122
           +A+ FILKC + +P+ R  A  L+   F+K      
Sbjct: 254 EAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKK 289


>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.95
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.95
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.94
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.94
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.94
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.94
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.94
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.92
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.92
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.92
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.91
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.9
4aoj_A329 High affinity nerve growth factor receptor; transf 99.9
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.9
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.89
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.89
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.88
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.88
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.88
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.88
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.87
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.86
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.86
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.86
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.86
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.86
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.86
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.86
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.86
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.85
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.85
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.85
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.85
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.85
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.85
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.85
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.85
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.85
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.85
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.85
3niz_A311 Rhodanese family protein; structural genomics, str 99.85
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.85
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.85
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.85
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.85
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.84
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.84
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.84
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.84
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.84
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.84
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.84
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.84
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.84
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.84
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.84
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.84
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.84
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.84
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.84
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.83
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.83
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.83
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.83
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.83
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.83
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.83
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.83
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.83
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.83
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.83
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.83
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.83
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.83
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.83
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.83
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.83
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.83
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.83
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.83
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.83
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.82
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.82
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.82
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.82
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.82
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.82
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.82
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.82
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.82
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.82
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.82
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.82
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.82
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.82
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.82
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.82
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.82
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.82
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.81
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.81
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.81
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.81
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.81
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.81
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.81
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.81
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.81
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.81
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.81
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.81
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.81
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.81
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.81
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.81
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.81
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.81
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.81
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.8
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.8
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.8
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.8
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.8
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.8
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.8
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.8
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.8
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.8
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.8
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.8
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.8
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.8
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.8
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.79
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.79
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.79
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.79
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.79
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.79
3bhy_A283 Death-associated protein kinase 3; death associate 99.79
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.79
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.79
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.79
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.79
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.79
3ork_A311 Serine/threonine protein kinase; structural genomi 99.78
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.78
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.77
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.77
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.77
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.77
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.77
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.77
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.77
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.76
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.76
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.76
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.75
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.75
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.75
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.75
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.75
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.75
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.75
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.75
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.75
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.75
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.75
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.75
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.74
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.74
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.74
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.74
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.74
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.74
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.74
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.74
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.74
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.74
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.74
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.74
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.74
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.73
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.73
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.73
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.73
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.73
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.73
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.73
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.72
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.72
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.72
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.72
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.72
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.72
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.71
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.71
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.71
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.71
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.7
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.7
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.7
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.7
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.7
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.7
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.7
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.7
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.7
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.7
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.7
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.69
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.69
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.69
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.69
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.69
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.69
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.68
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.68
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.67
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.67
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.67
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.66
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.66
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.66
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.66
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.65
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.65
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.65
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.64
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.64
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.64
3soc_A322 Activin receptor type-2A; structural genomics cons 99.63
3q4u_A301 Activin receptor type-1; structural genomics conso 99.63
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.62
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.62
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.62
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.62
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.62
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.61
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.6
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.6
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.58
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.57
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.57
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.55
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.48
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.43
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.34
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.34
3uqc_A286 Probable conserved transmembrane protein; structur 99.15
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 96.85
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 94.65
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 91.84
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.95  E-value=7.8e-28  Score=162.13  Aligned_cols=111  Identities=21%  Similarity=0.346  Sum_probs=95.2

Q ss_pred             hcccccccccchhhhhccCCCCCchhhHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHcCCCCCCCCcccHHHHHHHHHh
Q 032711           16 KWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKC   95 (135)
Q Consensus        16 ~~~~gt~~~~aPE~~~~~~~~~~~~~dvws~G~~l~~l~~g~~p~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~li~~~   95 (135)
                      .+++||+.|||||++.+.  .|+.++|+||+||++|+|++|..||.+.+..+.+..+.+... ..|..+++++.+|+.+|
T Consensus       192 ~~~~GTp~YmAPEvl~~~--~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i~~~~~-~~p~~~s~~~~dli~~l  268 (311)
T 4aw0_A          192 NSFVGTAQYVSPELLTEK--SACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEY-DFPEKFFPKARDLVEKL  268 (311)
T ss_dssp             CCCCSCGGGCCHHHHHHS--CBCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHTCC-CCCTTCCHHHHHHHHHH
T ss_pred             cCcccCcccCCHHHHcCC--CCCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcCCC-CCCcccCHHHHHHHHHH
Confidence            457999999999999885  689999999999999999999999999888888888887765 56778999999999999


Q ss_pred             cccCCCCCCCHHH------HhhCcCCCCCCCCCCCCCCcc
Q 032711           96 LQVNPNDRPTAAQ------LMEHPFVKRPLPTSWGLPTPH  129 (135)
Q Consensus        96 l~~~p~~Rps~~~------~l~~~~~~~~~~~~~~~~~~~  129 (135)
                      |..||.+|++++|      +++||||++-.......-.|+
T Consensus       269 L~~dp~~R~t~~e~~~~~~i~~Hp~F~~idw~~l~~~~pP  308 (311)
T 4aw0_A          269 LVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPP  308 (311)
T ss_dssp             SCSSGGGSTTSGGGTCHHHHHTSGGGTTCCCTTGGGSCCC
T ss_pred             ccCCHhHCcChHHHcCCHHHHCCCCcCCCCHHHhcCCCCC
Confidence            9999999999987      588999998655444333343



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-30
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 6e-30
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-30
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-28
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 7e-28
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-27
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-27
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-26
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-26
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-26
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-26
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-25
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-25
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-23
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-23
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 8e-23
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-22
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-22
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-22
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-22
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-22
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-22
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-22
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 8e-22
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-21
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-21
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-21
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-21
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-21
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-21
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-21
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-21
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-21
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 6e-21
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-21
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 8e-21
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 9e-21
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-20
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-20
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-20
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-20
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-20
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-20
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-20
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-19
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-19
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-19
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 8e-19
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-18
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-18
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-18
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-17
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 3e-17
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-17
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 9e-17
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-16
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-16
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-15
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-14
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-13
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-13
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 6e-13
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  107 bits (268), Expect = 6e-30
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 33  KNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPI--PDSVSRDARD 90
               YG   DIWS+G   +EM+    PY     ++AL+ IA    P +  P+ +S   RD
Sbjct: 189 TRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRD 248

Query: 91  FILKCLQVNPNDRPTAAQLMEHPFVKRPLPTS 122
           F+ +CL ++   R +A +L++H F+K   P S
Sbjct: 249 FLNRCLDMDVEKRGSAKELLQHQFLKIAKPLS 280


>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.94
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.94
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.93
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.93
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.92
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.92
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.92
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.92
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.92
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.92
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.92
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.91
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.91
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.91
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.91
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.91
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.9
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.9
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.9
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.89
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.89
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.88
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.88
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.88
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.87
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.87
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.87
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.87
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.87
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.86
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.86
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.86
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.86
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.86
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.86
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.86
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.86
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.85
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.85
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.85
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.85
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.85
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.85
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.85
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.85
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.84
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.84
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.84
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.84
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.82
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.82
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.81
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.81
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.81
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.81
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.79
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.78
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.76
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.68
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.66
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=7.1e-27  Score=153.59  Aligned_cols=98  Identities=24%  Similarity=0.461  Sum_probs=87.6

Q ss_pred             hcccccccccchhhhhccCCCCCchhhHHHHHHHHHHHHhCCCCCCCCcHHHHHHHHHcCCCCCCCCcccHHHHHHHHHh
Q 032711           16 KWHVSRWNSLTDQVVNSKNGGYGLPADIWSVGCTVLEMLTRCRPYFGVEWVQALFKIARGELPPIPDSVSRDARDFILKC   95 (135)
Q Consensus        16 ~~~~gt~~~~aPE~~~~~~~~~~~~~dvws~G~~l~~l~~g~~p~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~li~~~   95 (135)
                      ...+||+.|+|||++.+.  .|+.++||||+|+++|+|++|..||.+.+..+....+..+.....+..+++++.+++.+|
T Consensus       172 ~~~~gt~~Y~APE~l~~~--~~~~~~DIwSlGvilyel~tg~~Pf~~~~~~~~~~~i~~~~~~~~~~~~s~~l~~li~~~  249 (269)
T d2java1         172 KAFVGTPYYMSPEQMNRM--SYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRM  249 (269)
T ss_dssp             ----CCCSCCCHHHHTTC--CCCHHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHHTCCCCCCTTSCHHHHHHHHHH
T ss_pred             ccCCCCcccCCHHHHcCC--CCChHHHHHhhCHHHHHHhhCCCCCCCCCHHHHHHHHHcCCCCCCCcccCHHHHHHHHHH
Confidence            346899999999999774  689999999999999999999999999888888888888877777888999999999999


Q ss_pred             cccCCCCCCCHHHHhhCcCC
Q 032711           96 LQVNPNDRPTAAQLMEHPFV  115 (135)
Q Consensus        96 l~~~p~~Rps~~~~l~~~~~  115 (135)
                      |..||.+||++.|+++|||+
T Consensus       250 L~~dp~~Rps~~ell~hp~i  269 (269)
T d2java1         250 LNLKDYHRPSVEEILENPLI  269 (269)
T ss_dssp             TCSSGGGSCCHHHHHTSTTC
T ss_pred             cCCChhHCcCHHHHHhCCcC
Confidence            99999999999999999996



>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure