Citrus Sinensis ID: 032745


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLILGLAFAVRHYTKKE
cccccccccHHHHHcccccccEEEEEccEEEEcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHcccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****PKI*QFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDID**********************TPEFIIKILQILVPLLILGLAFAVRHYTKK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLILGLAFAVRHYTKKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b5 isoform A Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.confidentQ42342
Cytochrome b5 Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.confidentP49100
Cytochrome b5 Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.probableP40934

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HKO, chain A
Confidence level:very confident
Coverage over the Query: 2-87
View the alignment between query and template
View the model in PyMOL