Citrus Sinensis ID: 032750


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTKYTPPKQPHYNQDKTPEFIIKLLQFLVPLLILGLAVGIRFYTKSA
cccccccEEHHHHHcccccccEEEEEccEEEEcccccccccccHHHHHHHcccccccccccccccHHHHHHHHHcEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
****GKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDID***********************PEFIIKLLQFLVPLLILGLAVGIRFYTKS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTKYTPPKQPHYNQDKTPEFIIKLLQFLVPLLILGLAVGIRFYTKSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b5 isoform B Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.confidentO48845
Cytochrome b5 Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.confidentP49100
Cytochrome b5 Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. May play a key role in the modification by desaturation of fatty acids in the endoplasmic reticulum, which in the developing seed is utilized for membrane synthesis and in the developmentally regulated production of large amounts of storage lipids. Is involved in the reduction of cytochrome P-450 and may therefore be involved in flavonoid biosynthesis in the petals.probableP49098

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HKO, chain A
Confidence level:very confident
Coverage over the Query: 2-87
View the alignment between query and template
View the model in PyMOL