Query         032762
Match_columns 134
No_of_seqs    156 out of 233
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:37:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032762.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032762hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07172 GRP:  Glycine rich pro  99.9 2.3E-22 5.1E-27  142.9  10.6   47    1-55      1-47  (95)
  2 PF07172 GRP:  Glycine rich pro  98.5 9.8E-07 2.1E-11   62.8   8.8   28    6-33     10-37  (95)
  3 PF03058 Sar8_2:  Sar8.2 family  98.0 7.2E-06 1.6E-10   58.1   3.4   33    1-33      1-34  (93)
  4 PF15240 Pro-rich:  Proline-ric  92.8   0.058 1.2E-06   42.6   1.5   17    8-24      2-18  (179)
  5 COG4371 Predicted membrane pro  92.3    0.59 1.3E-05   39.4   6.9   17    4-20     23-39  (334)
  6 PF10731 Anophelin:  Thrombin i  90.3    0.25 5.5E-06   32.9   2.3   14    1-14      1-14  (65)
  7 PF05887 Trypan_PARP:  Procycli  90.0   0.091   2E-06   40.0   0.0   29    1-29      1-29  (143)
  8 PLN03134 glycine-rich RNA-bind  84.2     1.2 2.7E-05   33.2   3.2   34   15-52     79-112 (144)
  9 PHA02291 hypothetical protein   81.9     1.3 2.7E-05   32.9   2.4   15    1-15      1-15  (132)
 10 PF03896 TRAP_alpha:  Transloco  80.2     1.2 2.6E-05   37.4   2.0   18    1-18      3-20  (285)
 11 COG3784 Uncharacterized protei  79.8     2.4 5.2E-05   30.9   3.2   31    1-33      1-31  (109)
 12 PLN00115 pollen allergen group  79.0     1.9 4.1E-05   31.9   2.5   22    1-22      1-22  (118)
 13 COG4704 Uncharacterized protei  77.3     2.9 6.4E-05   32.1   3.2   29    1-29      1-29  (151)
 14 PRK15058 cytochrome b562; Prov  74.4     4.5 9.8E-05   30.4   3.5   19   15-33     12-30  (128)
 15 PF03032 Brevenin:  Brevenin/es  74.3     1.7 3.6E-05   27.2   1.0   19    3-21      3-21  (46)
 16 PRK02898 cobalt transport prot  73.2       7 0.00015   28.3   4.1   11   23-33     38-48  (100)
 17 PF15284 PAGK:  Phage-encoded v  71.0     6.7 0.00014   26.0   3.3   11   17-27     18-28  (61)
 18 TIGR03068 srtB_sig_NPQTN sorta  70.6       4 8.7E-05   23.9   1.9   20    2-21      7-26  (33)
 19 COG4991 Uncharacterized protei  68.0     5.9 0.00013   30.7   3.0   21    2-22      9-29  (155)
 20 PF02553 CbiN:  Cobalt transpor  64.7      13 0.00028   25.5   3.8   10   23-32     36-45  (74)
 21 TIGR03045 PS_II_C550 cytochrom  63.2     7.1 0.00015   30.2   2.6   25    9-33      9-33  (159)
 22 CHL00133 psbV photosystem II c  62.7     7.1 0.00015   30.4   2.6   30    4-33      3-34  (163)
 23 PRK13619 psbV cytochrome c-550  62.4     6.8 0.00015   30.5   2.4   25    9-33      9-33  (160)
 24 PRK10301 hypothetical protein;  62.2      10 0.00022   27.8   3.2   13   15-27     16-28  (124)
 25 PF07423 DUF1510:  Protein of u  61.4     5.6 0.00012   32.2   1.8   13    9-21     26-38  (217)
 26 PRK09125 DNA ligase; Provision  60.8     3.9 8.5E-05   33.8   0.9   17    9-25     10-26  (282)
 27 TIGR01659 sex-lethal sex-letha  59.3      13 0.00029   31.6   3.9   19   15-33    238-256 (346)
 28 PRK13617 psbV cytochrome c-550  58.2     7.1 0.00015   30.7   1.8   13   19-31     27-39  (170)
 29 PF02419 PsbL:  PsbL protein;    57.6      14 0.00031   22.1   2.6   15    7-21     19-33  (37)
 30 PRK15396 murein lipoprotein; P  57.6      12 0.00026   25.7   2.7   19    1-19      1-19  (78)
 31 TIGR02953 penta_MxKDx pentapep  56.3      12 0.00027   25.7   2.6   21    7-27      3-23  (75)
 32 PF09403 FadA:  Adhesion protei  56.0     4.9 0.00011   30.0   0.6   19    4-22      2-20  (126)
 33 PRK13620 psbV cytochrome c-550  55.0      10 0.00023   30.8   2.4   24   10-33     63-86  (215)
 34 PF12276 DUF3617:  Protein of u  54.8     6.1 0.00013   29.2   1.0    9    4-12      2-10  (162)
 35 COG3354 FlaG Putative archaeal  53.3      14 0.00031   28.5   2.8   21    1-21      1-21  (154)
 36 PF06411 HdeA:  HdeA/HdeB famil  52.8     4.6 9.9E-05   28.0   0.0   17    4-20      1-17  (94)
 37 PLN03207 stomagen; Provisional  52.2      13 0.00028   27.1   2.3    8  113-120    84-91  (113)
 38 PF10690 Myticin-prepro:  Mytic  52.0     4.8  0.0001   28.9   0.0   16    4-19      2-17  (98)
 39 PRK10772 cell division protein  51.3      24 0.00052   25.7   3.6   26    8-33     30-55  (108)
 40 PRK13618 psbV cytochrome c-550  51.1      18 0.00039   28.1   3.0   13   21-33     22-34  (163)
 41 PF10749 DUF2534:  Protein of u  50.3      32 0.00068   24.2   3.9   21    3-23     12-33  (85)
 42 PLN03161 Probable xyloglucan e  48.9      11 0.00024   31.8   1.7   21    1-21      1-21  (291)
 43 COG2869 NqrC Na+-transporting   48.8     8.8 0.00019   32.0   1.1   18    6-23     15-32  (264)
 44 TIGR01495 ETRAMP Plasmodium ri  48.6      14  0.0003   25.8   1.9   18    3-20      4-21  (85)
 45 TIGR02209 ftsL_broad cell divi  47.6      41 0.00089   22.1   4.1   11   15-25     16-26  (85)
 46 COG2854 Ttg2D ABC-type transpo  47.5     8.7 0.00019   30.9   0.8   20    1-20      2-21  (202)
 47 PRK15240 resistance to complem  47.4      12 0.00026   29.2   1.6   16    4-19      2-17  (185)
 48 PF00879 Defensin_propep:  Defe  47.2      16 0.00034   23.5   1.8   12   17-28     11-22  (52)
 49 COG3495 Uncharacterized protei  46.5      14 0.00031   28.7   1.8   21    4-24      2-22  (166)
 50 PF03823 Neurokinin_B:  Neuroki  45.3      33 0.00073   22.5   3.2   14    7-20      5-18  (59)
 51 PF12048 DUF3530:  Protein of u  45.0      20 0.00044   29.9   2.7   22    5-26      4-25  (310)
 52 PF05399 EVI2A:  Ectropic viral  44.8      33 0.00073   28.1   3.8   16   15-30    145-160 (227)
 53 KOG4087 Phospholipase A2 [Lipi  44.0      64  0.0014   24.8   5.0   30    4-33      2-33  (144)
 54 COG5510 Predicted small secret  44.0      32 0.00069   21.4   2.8   12    9-20     10-21  (44)
 55 PF12092 DUF3568:  Protein of u  43.8      17 0.00036   27.2   1.8   14    4-17      1-14  (131)
 56 PRK10894 lipopolysaccharide tr  42.9      20 0.00043   27.5   2.2   10   14-23     12-21  (180)
 57 PHA03255 BDLF3; Provisional     42.4      21 0.00045   28.7   2.2   14    6-19    194-207 (234)
 58 PF07438 DUF1514:  Protein of u  41.9      40 0.00087   22.6   3.2   14    8-21      4-17  (66)
 59 PF05513 TraA:  TraA;  InterPro  41.6      34 0.00073   25.5   3.1   23    9-31     39-61  (119)
 60 PF12869 tRNA_anti-like:  tRNA_  41.2      10 0.00022   27.3   0.3    9    1-9       1-10  (144)
 61 PRK09810 entericidin A; Provis  41.2      33  0.0007   21.0   2.5    8    4-11      3-10  (41)
 62 PRK06531 yajC preprotein trans  41.2      47   0.001   24.3   3.8   20    1-20      1-20  (113)
 63 PF12097 DUF3573:  Protein of u  41.1      18  0.0004   31.6   1.9   21    1-21      1-21  (383)
 64 PRK10260 L,D-transpeptidase; P  41.1      18 0.00039   30.8   1.8   24    1-25      1-24  (306)
 65 PF04885 Stig1:  Stigma-specifi  41.0     8.6 0.00019   29.1  -0.1   15    7-21      3-17  (136)
 66 PF12477 TraW_N:  Sex factor F   41.0      15 0.00032   21.1   0.9   13   15-27      8-20  (31)
 67 PRK10318 hypothetical protein;  40.6      31 0.00067   25.8   2.8   11    7-17      6-16  (121)
 68 TIGR00547 lolA periplasmic cha  40.0      38 0.00083   26.7   3.4    6    6-11      5-10  (204)
 69 PRK09455 rseB anti-sigma E fac  39.8      15 0.00032   31.1   1.1   21    4-24      2-22  (319)
 70 PLN00212 glutelin; Provisional  39.8      28  0.0006   31.5   2.9   20    1-21      1-20  (493)
 71 COG3017 LolB Outer membrane li  39.7      19 0.00041   29.2   1.6   21    2-22      3-23  (206)
 72 PF06796 NapE:  Periplasmic nit  39.6      35 0.00076   22.2   2.6   15    4-18     19-33  (56)
 73 PF11912 DUF3430:  Protein of u  39.4      25 0.00053   26.9   2.2   15    4-18      2-16  (212)
 74 PLN03024 Putative EG45-like do  38.4      19 0.00042   26.6   1.4    9    2-10      1-9   (125)
 75 PRK00753 psbL photosystem II r  38.4      36 0.00078   20.6   2.3   11   11-21     25-35  (39)
 76 PF12930 DUF3836:  Family of un  38.0     9.2  0.0002   28.6  -0.3   12    4-15      8-19  (132)
 77 PF14060 DUF4252:  Domain of un  37.5      54  0.0012   23.8   3.8    8    4-11      1-8   (155)
 78 PRK12750 cpxP periplasmic repr  36.9      31 0.00067   26.7   2.4   14    3-16      4-17  (170)
 79 PF14147 Spore_YhaL:  Sporulati  36.7      74  0.0016   20.4   3.7   17    6-22      7-23  (52)
 80 COG4856 Uncharacterized protei  36.6      23  0.0005   31.3   1.8   19    2-20      6-25  (403)
 81 PRK15307 major fimbrial protei  36.4      30 0.00066   26.9   2.3   15    1-15      1-15  (201)
 82 PRK10780 periplasmic chaperone  35.9      43 0.00093   25.2   3.0    6    4-9       2-7   (165)
 83 PLN00213 predicted protein; Pr  35.8      29 0.00063   25.8   2.0   19    1-19      1-19  (118)
 84 PRK13881 conjugal transfer pro  35.7      50  0.0011   29.9   3.8   20   13-32     38-57  (472)
 85 COG4890 Predicted outer membra  35.6      75  0.0016   18.9   3.3   24    8-32      7-30  (37)
 86 TIGR02972 TMAO_torE trimethyla  35.5      46   0.001   20.9   2.6   14    4-17     11-24  (47)
 87 PRK12592 putative monovalent c  35.4      93   0.002   23.2   4.7   18   12-29     80-97  (126)
 88 PF02699 YajC:  Preprotein tran  35.3      87  0.0019   21.2   4.2   16    6-21      5-20  (82)
 89 COG4313 Protein involved in me  35.3      28 0.00062   29.7   2.1   15    1-15      4-18  (304)
 90 PRK11063 metQ DL-methionine tr  35.0      37 0.00081   27.7   2.7   12    1-12      1-14  (271)
 91 PRK13893 conjugal transfer pro  34.7      24 0.00052   28.3   1.5   16    1-17      1-16  (193)
 92 KOG4207 Predicted splicing fac  34.5     8.3 0.00018   31.8  -1.1   36   15-54     58-93  (256)
 93 PF11839 DUF3359:  Protein of u  34.2      38 0.00081   24.3   2.3   15    4-18      2-16  (96)
 94 COG4238 Murein lipoprotein [Ce  34.2      36 0.00078   23.5   2.1   18    1-18      1-18  (78)
 95 PRK10641 btuB vitamin B12/coba  34.0      10 0.00022   33.3  -0.8   16    1-16      1-16  (614)
 96 PF11162 DUF2946:  Protein of u  33.9      56  0.0012   21.5   3.1   12    5-16      3-14  (122)
 97 TIGR02973 nitrate_rd_NapE peri  33.7      53  0.0011   20.2   2.6   16    4-19      6-21  (42)
 98 PF13623 SurA_N_2:  SurA N-term  33.7      20 0.00044   26.9   0.9   18    6-23     10-27  (145)
 99 PF05984 Cytomega_UL20A:  Cytom  33.7      31 0.00066   24.6   1.7   19    1-21      1-19  (100)
100 PF09919 DUF2149:  Uncharacteri  33.5      47   0.001   23.4   2.7   20    1-20      1-21  (92)
101 PRK03577 acid shock protein pr  33.5      37 0.00079   24.6   2.1   16    8-23      4-19  (102)
102 COG1930 CbiN ABC-type cobalt t  33.0      49  0.0011   23.8   2.7    9   10-18     13-21  (97)
103 PRK06193 hypothetical protein;  32.8      19  0.0004   28.8   0.6    9    1-9       1-9   (206)
104 PF09716 ETRAMP:  Malarial earl  32.5      38 0.00082   23.2   2.1   17    3-19      4-20  (84)
105 MTH00261 ATP8 ATP synthase F0   32.4      46   0.001   22.0   2.3   15    6-20     14-28  (68)
106 PF14208 DUF4320:  Domain of un  32.4      71  0.0015   23.3   3.6   21    7-27      7-27  (116)
107 COG4744 Uncharacterized conser  32.3      46   0.001   24.7   2.6    7    9-15     31-37  (121)
108 COG3116 FtsL Cell division pro  32.2      77  0.0017   23.1   3.6   22   10-31     30-51  (105)
109 COG2834 LolA Outer membrane li  32.1      52  0.0011   25.7   3.0    7   24-30     28-34  (211)
110 CHL00038 psbL photosystem II p  32.1      53  0.0012   19.8   2.3   10   12-21     25-34  (38)
111 TIGR02830 spore_III_AG stage I  32.1      40 0.00087   26.7   2.4   14    7-20      6-19  (186)
112 COG3745 CpaB Flp pilus assembl  32.0      42 0.00092   28.3   2.6   18    1-18      1-18  (276)
113 PRK13838 conjugal transfer pil  31.9      54  0.0012   25.4   3.0   12    1-12      1-12  (176)
114 PRK15137 DNA-specific endonucl  31.9      28 0.00061   28.7   1.5   11    1-11      1-11  (235)
115 PRK11067 outer membrane protei  31.2      38 0.00083   31.2   2.4   12    1-12      1-12  (803)
116 PRK13680 hypothetical protein;  30.4      41 0.00089   25.0   2.0   15    5-19      5-19  (117)
117 PRK05886 yajC preprotein trans  30.3      79  0.0017   23.0   3.5   16    6-21      7-22  (109)
118 TIGR03656 IsdC heme uptake pro  29.9      29 0.00062   28.3   1.2   21    4-24      2-24  (217)
119 PRK11566 hdeB acid-resistance   28.6      47   0.001   24.1   2.0   17    4-20      2-18  (102)
120 PF12555 TPPK_C:  Thiamine pyro  28.6      80  0.0017   19.8   2.9    8    9-16     21-28  (53)
121 PF02402 Lysis_col:  Lysis prot  28.4      16 0.00035   22.9  -0.3   17    5-21      3-19  (46)
122 PF02084 Bindin:  Bindin;  Inte  28.3 3.1E+02  0.0066   22.8   6.9    6   28-33    156-161 (238)
123 TIGR03778 VPDSG_CTERM VPDSG-CT  28.3      83  0.0018   17.5   2.5   13    5-17      7-19  (26)
124 PF07437 YfaZ:  YfaZ precursor;  28.2      29 0.00064   27.0   1.0   22    4-27      2-23  (180)
125 PF06692 MNSV_P7B:  Melon necro  28.1      56  0.0012   21.4   2.1   10    7-16     16-25  (61)
126 PRK11009 aphA acid phosphatase  28.1      49  0.0011   26.8   2.3   17    4-20      2-18  (237)
127 PLN02682 pectinesterase family  28.0      20 0.00044   31.2   0.1   17    7-23      7-23  (369)
128 TIGR02659 TTQ_MADH_Lt methylam  28.0      40 0.00088   26.9   1.7   30  102-134   130-159 (186)
129 PF06103 DUF948:  Bacterial pro  27.9      71  0.0015   21.4   2.8   13    5-17      9-21  (90)
130 PF13893 RRM_5:  RNA recognitio  27.9     8.1 0.00018   23.3  -1.8   31   15-49     24-54  (56)
131 COG4727 Uncharacterized protei  27.7      68  0.0015   26.9   3.1   15    1-15      1-15  (287)
132 COG5353 Uncharacterized protei  27.6      67  0.0015   25.0   2.9   13    9-21     17-29  (161)
133 PRK06287 cobalt transport prot  27.4      74  0.0016   22.8   2.9   11    1-11      2-12  (107)
134 PRK05996 motB flagellar motor   27.3      98  0.0021   27.6   4.2    8    8-15     43-50  (423)
135 PRK09838 periplasmic copper-bi  26.9      57  0.0012   23.8   2.3    9   13-21     10-18  (115)
136 PF07271 Cytadhesin_P30:  Cytad  26.7      78  0.0017   26.8   3.3   12    6-17     12-23  (279)
137 KOG0111 Cyclophilin-type pepti  26.6      14 0.00031   30.8  -1.1   26   24-53     64-89  (298)
138 PF01307 Plant_vir_prot:  Plant  26.4      51  0.0011   23.7   1.9   18    3-20      8-25  (104)
139 KOG3555 Ca2+-binding proteogly  26.2      72  0.0016   28.2   3.1   20    5-24      3-22  (434)
140 COG1320 MnhG Multisubunit Na+/  26.1      93   0.002   22.7   3.3   23   11-33     70-92  (113)
141 PF10614 CsgF:  Type VIII secre  25.9      24 0.00053   26.9   0.2   23    4-28      2-24  (142)
142 PRK10455 periplasmic protein;   25.6      68  0.0015   24.6   2.6   13   10-22      6-18  (161)
143 PRK10208 acid-resistance prote  25.6      56  0.0012   24.2   2.0   16    4-19      5-22  (114)
144 CHL00066 psbH photosystem II p  25.4      55  0.0012   22.4   1.8   10   12-21     49-58  (73)
145 PRK10095 ribonuclease I; Provi  25.4      44 0.00095   27.8   1.6    6  115-120   118-123 (268)
146 PRK09973 putative outer membra  25.4      76  0.0017   22.2   2.6   15    4-18      3-17  (85)
147 PF03866 HAP:  Hydrophobic abun  25.2      98  0.0021   23.9   3.3   20    5-24      3-22  (164)
148 PRK11372 lysozyme inhibitor; P  25.1      65  0.0014   23.2   2.3   11    1-11      1-11  (109)
149 PF07127 Nodulin_late:  Late no  25.1      75  0.0016   19.7   2.3    9    9-17     11-19  (54)
150 PHA02054 hypothetical protein   25.0      46   0.001   23.5   1.4   20    3-22      2-21  (94)
151 COG3470 Tpd Uncharacterized pr  24.9      62  0.0013   25.5   2.2   16    1-16      1-16  (179)
152 COG1991 Uncharacterized conser  24.5 1.1E+02  0.0023   23.2   3.4    6    3-8      17-22  (131)
153 PRK01326 prsA foldase protein   24.3      65  0.0014   26.8   2.5    9    4-12      3-11  (310)
154 PRK09125 DNA ligase; Provision  24.2      38 0.00083   27.9   1.1   16    6-21      1-16  (282)
155 PLN00055 photosystem II reacti  23.9      61  0.0013   22.2   1.8   10   12-21     49-58  (73)
156 PF05479 PsaN:  Photosystem I r  23.9      25 0.00055   26.8  -0.1    7    6-12     34-40  (138)
157 PRK03554 tatA twin arginine tr  23.8      64  0.0014   22.9   2.0    8    8-15     10-17  (89)
158 PF08999 SP_C-Propep:  Surfacta  23.8   1E+02  0.0023   21.7   3.0   15    4-18     34-48  (93)
159 PF04956 TrbC:  TrbC/VIRB2 fami  23.7      79  0.0017   21.4   2.4   12   15-26     20-31  (99)
160 PF11355 DUF3157:  Protein of u  23.5      51  0.0011   26.6   1.6   12    4-15      2-13  (199)
161 PLN02713 Probable pectinestera  23.5      71  0.0015   29.3   2.7   21    1-21      1-21  (566)
162 PF07771 TSGP1:  Tick salivary   23.4      36 0.00078   25.1   0.7    8   98-105    70-77  (120)
163 TIGR01944 rnfB electron transp  23.1      57  0.0012   24.6   1.8   16    8-23     11-26  (165)
164 PF14991 MLANA:  Protein melan-  23.1      28  0.0006   25.9   0.0   13    8-20     31-43  (118)
165 PRK14018 trifunctional thiored  22.9      70  0.0015   29.1   2.5   22    1-22      1-22  (521)
166 PF10956 DUF2756:  Protein of u  22.9      67  0.0015   23.4   2.0    9    4-12      2-10  (104)
167 PRK02463 OxaA-like protein pre  22.5      78  0.0017   26.8   2.6   19    4-22      6-24  (307)
168 PRK10259 hypothetical protein;  22.4      94   0.002   21.7   2.6   12    5-16      5-16  (86)
169 PF11777 DUF3316:  Protein of u  22.4      89  0.0019   22.2   2.6    7    4-10      2-8   (114)
170 PF07312 DUF1459:  Protein of u  22.4      81  0.0018   22.1   2.2   11    1-11      1-11  (84)
171 PF06990 Gal-3-0_sulfotr:  Gala  22.4      44 0.00096   29.2   1.1   19    3-21     17-35  (402)
172 PRK11443 lipoprotein; Provisio  22.2      73  0.0016   23.5   2.1    8    4-11      2-9   (124)
173 KOG4742 Predicted chitinase [G  22.2      65  0.0014   27.3   2.1    7  106-112   171-177 (286)
174 TIGR00842 bcct choline/carniti  22.2 1.6E+02  0.0035   26.3   4.6   19    6-24    358-376 (453)
175 PF00737 PsbH:  Photosystem II   22.1      69  0.0015   20.6   1.7    9   12-20     34-42  (52)
176 PLN00054 photosystem I reactio  22.0      72  0.0016   24.2   2.0    7   27-33     58-64  (139)
177 PRK01622 OxaA-like protein pre  22.0      85  0.0018   25.6   2.7   21    2-22      3-23  (256)
178 TIGR02052 MerP mercuric transp  21.9      73  0.0016   19.6   1.8    6    4-9       2-7   (92)
179 PF13999 MarB:  MarB protein     21.9      68  0.0015   21.6   1.7    7   16-22      8-14  (66)
180 PRK12450 foldase protein PrsA;  21.9      86  0.0019   26.1   2.7   13    3-15      4-16  (309)
181 PF07390 P30:  Mycoplasma P30 p  21.8      43 0.00092   27.5   0.8   20    1-20      1-20  (266)
182 TIGR00156 conserved hypothetic  21.7      87  0.0019   23.3   2.4    6    4-9       2-7   (126)
183 PRK12587 putative monovalent c  21.5 1.9E+02  0.0041   21.2   4.2   16   12-27     73-88  (118)
184 KOG4251 Calcium binding protei  21.5      26 0.00056   29.8  -0.5   28    1-30      8-41  (362)
185 PRK06778 hypothetical protein;  21.5   1E+02  0.0023   25.6   3.1    9   25-33     51-59  (289)
186 PRK15206 long polar fimbrial p  21.5      70  0.0015   27.8   2.2   17    1-17      1-17  (359)
187 PRK10510 putative outer membra  21.5      78  0.0017   25.2   2.3   20    3-22      2-21  (219)
188 TIGR03043 PS_II_psbZ photosyst  21.4   1E+02  0.0022   20.1   2.4   17    5-21      3-19  (58)
189 PRK12670 putative monovalent c  21.2   2E+02  0.0044   20.3   4.2   20   11-30     66-85  (99)
190 PRK13871 conjugal transfer pro  21.1      96  0.0021   23.6   2.6    9    1-9       1-9   (135)
191 PF01737 Ycf9:  YCF9;  InterPro  21.1 1.1E+02  0.0024   20.1   2.5   17    5-21      3-19  (59)
192 TIGR03063 srtB_target sortase   20.9 1.4E+02  0.0029   16.9   2.6    9    6-14     11-19  (29)
193 PF15281 Consortin_C:  Consorti  20.9      83  0.0018   23.2   2.1   14    7-20     55-68  (113)
194 PF06404 PSK:  Phytosulfokine p  20.7      28  0.0006   24.0  -0.4   10   20-29     10-19  (81)
195 PF06716 DUF1201:  Protein of u  20.7 1.5E+02  0.0032   18.9   2.9    7    4-10      6-12  (54)
196 COG3637 Opacity protein and re  20.7      94   0.002   24.2   2.6    8    4-11      2-9   (199)
197 PRK13792 lysozyme inhibitor; P  20.6      70  0.0015   23.9   1.7    8    4-11      3-10  (127)
198 PF01998 DUF131:  Protein of un  20.6 1.2E+02  0.0026   20.1   2.6   14    4-17     42-55  (64)
199 CHL00190 psaM photosystem I su  20.5 1.8E+02   0.004   16.5   3.8   15    1-15      1-15  (30)
200 PRK11546 zraP zinc resistance   20.5 1.3E+02  0.0028   23.0   3.2   15   12-26     13-27  (143)
201 PF12988 DUF3872:  Domain of un  20.4      34 0.00073   26.1   0.0   22    1-22      1-22  (137)
202 TIGR03302 OM_YfiO outer membra  20.4      61  0.0013   24.5   1.4   11    9-19      4-14  (235)
203 TIGR02738 TrbB type-F conjugat  20.3 1.7E+02  0.0036   22.0   3.8   10    4-13      3-12  (153)
204 PRK03625 tatE twin arginine tr  20.3      77  0.0017   21.2   1.7   10    8-17     10-19  (67)
205 COG2143 Thioredoxin-related pr  20.3      95  0.0021   24.6   2.5    7   13-19     10-16  (182)
206 PLN02196 abscisic acid 8'-hydr  20.1      86  0.0019   26.8   2.4   19    1-19      1-19  (463)
207 PRK08055 chorismate mutase; Pr  20.1 1.4E+02  0.0031   23.4   3.5    6   18-23     17-22  (181)
208 PRK09950 putative transporter;  20.0   2E+02  0.0043   26.1   4.8   19    6-24    404-422 (506)

No 1  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=99.88  E-value=2.3e-22  Score=142.95  Aligned_cols=47  Identities=60%  Similarity=0.868  Sum_probs=37.8

Q ss_pred             CchhHHHHHHHHHHHHHHhhhHHHHHHHHHhccccccCccccCcccccCCCccCC
Q 032762            1 MGSKVFLMLGLLVSIVLLISSEAAARDLAETSNDDQKNGEVAGETNGVDDAKYNG   55 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSevaArelaE~~~~~~~k~ev~~~~~gVndak~gG   55 (134)
                      ||||+||||+||||+||||||||+||+++++.+        ++++++|+|+++++
T Consensus         1 MaSK~~llL~l~LA~lLlisSevaa~~~~~~~~--------~~~~~~v~~~~~~g   47 (95)
T PF07172_consen    1 MASKAFLLLGLLLAALLLISSEVAARELEETEK--------EEEENEVQDDKYGG   47 (95)
T ss_pred             CchhHHHHHHHHHHHHHHHHhhhhhHHhhhccc--------cccCCCCCccccCC
Confidence            999999999999999999999999999843322        23456788887743


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=98.51  E-value=9.8e-07  Score=62.83  Aligned_cols=28  Identities=18%  Similarity=0.157  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            6 FLMLGLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         6 ~llL~l~la~~LlvSSevaArelaE~~~   33 (134)
                      .|||++||+++..+|++..+++.+++++
T Consensus        10 ~l~LA~lLlisSevaa~~~~~~~~~~~~   37 (95)
T PF07172_consen   10 GLLLAALLLISSEVAARELEETEKEEEE   37 (95)
T ss_pred             HHHHHHHHHHHhhhhhHHhhhccccccC
Confidence            4667777778888887666444333333


No 3  
>PF03058 Sar8_2:  Sar8.2 family;  InterPro: IPR004297 Members of this family are found in Solanaceae spp. plants, a taxonomic group (family) that includes pepper and tobacco plant species. Synthesis of these proteins is induced by Tobacco mosaic virus and salicylic acid []; indeed they are thought to be involved in the development of systemic acquired resistance (SAR) after an initial hypersensitive response to microbial infection [, ]. SAR is characterised by long-lasting resistance to infection by a wide range of pathogens, extending to plant tissues distant from the initial infection site [].
Probab=97.97  E-value=7.2e-06  Score=58.15  Aligned_cols=33  Identities=42%  Similarity=0.562  Sum_probs=27.6

Q ss_pred             CchhHHHHHHHHHHHHH-HhhhHHHHHHHHHhcc
Q 032762            1 MGSKVFLMLGLLVSIVL-LISSEAAARDLAETSN   33 (134)
Q Consensus         1 M~sK~~llL~l~la~~L-lvSSevaArelaE~~~   33 (134)
                      |+||+-|||.|.||++| .|||+|.|||..|++.
T Consensus         1 M~~Ktnlfl~lSLailLmIISSqv~AREms~A~a   34 (93)
T PF03058_consen    1 MVSKTNLFLCLSLAILLMIISSQVDAREMSKASA   34 (93)
T ss_pred             CcchhhhHHHHHHHHHHHHHhhHHHHHHHhcccc
Confidence            99999999999886654 6888999999887764


No 4  
>PF15240 Pro-rich:  Proline-rich
Probab=92.79  E-value=0.058  Score=42.62  Aligned_cols=17  Identities=35%  Similarity=0.421  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHhhhHHH
Q 032762            8 MLGLLVSIVLLISSEAA   24 (134)
Q Consensus         8 lL~l~la~~LlvSSeva   24 (134)
                      ||+||.|+||.+||+..
T Consensus         2 LlVLLSvALLALSSAQ~   18 (179)
T PF15240_consen    2 LLVLLSVALLALSSAQS   18 (179)
T ss_pred             hhHHHHHHHHHhhhccc
Confidence            56666677777887654


No 5  
>COG4371 Predicted membrane protein [Function unknown]
Probab=92.31  E-value=0.59  Score=39.37  Aligned_cols=17  Identities=12%  Similarity=0.397  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHHhh
Q 032762            4 KVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         4 K~~llL~l~la~~LlvS   20 (134)
                      |.++++.++||+.|++.
T Consensus        23 gT~~~~gfvLa~al~~~   39 (334)
T COG4371          23 GTLALGGFVLAAALFVP   39 (334)
T ss_pred             hhHHHHHHHHHHHHcCC
Confidence            44556666666655543


No 6  
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=90.32  E-value=0.25  Score=32.85  Aligned_cols=14  Identities=36%  Similarity=0.446  Sum_probs=8.6

Q ss_pred             CchhHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVS   14 (134)
Q Consensus         1 M~sK~~llL~l~la   14 (134)
                      ||||.||+-.|.+|
T Consensus         1 MA~Kl~vialLC~a   14 (65)
T PF10731_consen    1 MASKLIVIALLCVA   14 (65)
T ss_pred             CcchhhHHHHHHHH
Confidence            99986665444333


No 7  
>PF05887 Trypan_PARP:  Procyclic acidic repetitive protein (PARP);  InterPro: IPR008882 This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of T. brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated [].; GO: 0016020 membrane; PDB: 2X34_B 2X32_B.
Probab=89.99  E-value=0.091  Score=39.98  Aligned_cols=29  Identities=17%  Similarity=0.203  Sum_probs=0.0

Q ss_pred             CchhHHHHHHHHHHHHHHhhhHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSEAAARDLA   29 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSevaArela   29 (134)
                      |+-+.|+||+|||.+.+||+...+|+.+.
T Consensus         1 m~pr~l~~LavLL~~A~Lfag~g~AaAad   29 (143)
T PF05887_consen    1 MTPRHLCLLAVLLFGAALFAGVGSAAAAD   29 (143)
T ss_dssp             -----------------------------
T ss_pred             Ccccccccccccccccccccccccccccc
Confidence            77888888888777777777766555443


No 8  
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=84.24  E-value=1.2  Score=33.15  Aligned_cols=34  Identities=21%  Similarity=0.216  Sum_probs=23.6

Q ss_pred             HHHHhhhHHHHHHHHHhccccccCccccCcccccCCCc
Q 032762           15 IVLLISSEAAARDLAETSNDDQKNGEVAGETNGVDDAK   52 (134)
Q Consensus        15 ~~LlvSSevaArelaE~~~~~~~k~ev~~~~~gVndak   52 (134)
                      +||.+.++++|+.++++++ ..   ++..+.+.|+.++
T Consensus        79 aFV~F~~~e~A~~Al~~ln-g~---~i~Gr~l~V~~a~  112 (144)
T PLN03134         79 GFVNFNDEGAATAAISEMD-GK---ELNGRHIRVNPAN  112 (144)
T ss_pred             EEEEECCHHHHHHHHHHcC-CC---EECCEEEEEEeCC
Confidence            4677888888888888776 32   4566677776553


No 9  
>PHA02291 hypothetical protein
Probab=81.85  E-value=1.3  Score=32.91  Aligned_cols=15  Identities=27%  Similarity=0.344  Sum_probs=10.5

Q ss_pred             CchhHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSI   15 (134)
Q Consensus         1 M~sK~~llL~l~la~   15 (134)
                      |.||+.|+.+|++++
T Consensus         1 MS~K~~iFYiL~~~V   15 (132)
T PHA02291          1 MSRKASIFYILVVIV   15 (132)
T ss_pred             CCcchhhHHHHHHHH
Confidence            889987776665544


No 10 
>PF03896 TRAP_alpha:  Translocon-associated protein (TRAP), alpha subunit;  InterPro: IPR005595  The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane [].; GO: 0005783 endoplasmic reticulum
Probab=80.19  E-value=1.2  Score=37.40  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=9.4

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLL   18 (134)
Q Consensus         1 M~sK~~llL~l~la~~Ll   18 (134)
                      |.||.+||+.|+|.+.||
T Consensus         3 ~~~~~~ll~ll~~p~~l~   20 (285)
T PF03896_consen    3 FLSRLILLALLVFPATLL   20 (285)
T ss_pred             chhhHHHHHHHHHHHHHH
Confidence            346666665554444444


No 11 
>COG3784 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.79  E-value=2.4  Score=30.91  Aligned_cols=31  Identities=42%  Similarity=0.314  Sum_probs=21.3

Q ss_pred             CchhHHHHHHHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            1 MGSKVFLMLGLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSevaArelaE~~~   33 (134)
                      |-.|..|+|+|+++.  |+|+.+.|-++.|+.+
T Consensus         1 mm~~~~l~la~~a~g--l~s~sa~altld~A~t   31 (109)
T COG3784           1 MMMKRTLLLALLALG--LASSSAMALTLDEART   31 (109)
T ss_pred             CcHHHHHHHHHHHHh--hcchHHHHhhHHHHHh
Confidence            445677777776444  6777777888877765


No 12 
>PLN00115 pollen allergen group 3; Provisional
Probab=79.01  E-value=1.9  Score=31.86  Aligned_cols=22  Identities=27%  Similarity=0.457  Sum_probs=17.1

Q ss_pred             CchhHHHHHHHHHHHHHHhhhH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSe   22 (134)
                      |+|..+||++++||+++.+.+.
T Consensus         1 ~~~~~~~~~~~~~a~l~~~~~~   22 (118)
T PLN00115          1 MSSLSFLLLAVALAALFAVGSC   22 (118)
T ss_pred             CchhHHHHHHHHHHHHhhhhhc
Confidence            8888888877788887777654


No 13 
>COG4704 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=77.29  E-value=2.9  Score=32.06  Aligned_cols=29  Identities=31%  Similarity=0.170  Sum_probs=20.6

Q ss_pred             CchhHHHHHHHHHHHHHHhhhHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSEAAARDLA   29 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSevaArela   29 (134)
                      |-+|+.+-|.|++|++-|+++.++|.+++
T Consensus         1 m~~~~~~~l~Ll~aa~sL~~~~aaaaeat   29 (151)
T COG4704           1 MLNISRRRLFLLAAALSLVSLKAAAAEAT   29 (151)
T ss_pred             CccHHHHHHHHHHHHHHHHhHHHHHHhhc
Confidence            66777777778777777787777655543


No 14 
>PRK15058 cytochrome b562; Provisional
Probab=74.36  E-value=4.5  Score=30.37  Aligned_cols=19  Identities=32%  Similarity=0.359  Sum_probs=9.2

Q ss_pred             HHHHhhhHHHHHHHHHhcc
Q 032762           15 IVLLISSEAAARDLAETSN   33 (134)
Q Consensus        15 ~~LlvSSevaArelaE~~~   33 (134)
                      ++|++|+.+-|.++.+.|+
T Consensus        12 ~~l~~s~~a~Aa~l~~~M~   30 (128)
T PRK15058         12 SSLVFSSASFAADLEDNME   30 (128)
T ss_pred             HHHHHhHHHHHHHHHHHHH
Confidence            3344555444555555443


No 15 
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=74.30  E-value=1.7  Score=27.21  Aligned_cols=19  Identities=21%  Similarity=0.174  Sum_probs=10.9

Q ss_pred             hhHHHHHHHHHHHHHHhhh
Q 032762            3 SKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         3 sK~~llL~l~la~~LlvSS   21 (134)
                      .|+.|||.+||.++.|...
T Consensus         3 lKKsllLlfflG~ISlSlC   21 (46)
T PF03032_consen    3 LKKSLLLLFFLGTISLSLC   21 (46)
T ss_pred             chHHHHHHHHHHHcccchH
Confidence            3666777676655444433


No 16 
>PRK02898 cobalt transport protein CbiN; Provisional
Probab=73.24  E-value=7  Score=28.26  Aligned_cols=11  Identities=9%  Similarity=0.048  Sum_probs=5.1

Q ss_pred             HHHHHHHHhcc
Q 032762           23 AAARDLAETSN   33 (134)
Q Consensus        23 vaArelaE~~~   33 (134)
                      ..|++++++.+
T Consensus        38 ~~A~~~I~ei~   48 (100)
T PRK02898         38 GQAEEAITEIA   48 (100)
T ss_pred             HHHHHHHHHhC
Confidence            34555554433


No 17 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=70.99  E-value=6.7  Score=26.01  Aligned_cols=11  Identities=36%  Similarity=0.217  Sum_probs=5.2

Q ss_pred             HHhhhHHHHHH
Q 032762           17 LLISSEAAARD   27 (134)
Q Consensus        17 LlvSSevaAre   27 (134)
                      .++|+.+-|++
T Consensus        18 ~~FSasamAa~   28 (61)
T PF15284_consen   18 AGFSASAMAAD   28 (61)
T ss_pred             hhhhHHHHHHh
Confidence            34555554443


No 18 
>TIGR03068 srtB_sig_NPQTN sortase B signal domain, NPQTN class. This model represents one of the boutique (rare) sortase signals, recognized by sortase B (SrtB) rather than by the housekeeping-type SrtA class sortase. This sequence, beginning NPQTN, shows little similarity to several other SrtB substrates.
Probab=70.63  E-value=4  Score=23.89  Aligned_cols=20  Identities=25%  Similarity=0.428  Sum_probs=14.0

Q ss_pred             chhHHHHHHHHHHHHHHhhh
Q 032762            2 GSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         2 ~sK~~llL~l~la~~LlvSS   21 (134)
                      ++++++.++.+.++|||++-
T Consensus         7 gtp~y~y~Ip~v~lflL~~~   26 (33)
T TIGR03068         7 GTPAYIYAIPVASLALLIAI   26 (33)
T ss_pred             CCcchhhHHHHHHHHHHHHH
Confidence            45778887777777777753


No 19 
>COG4991 Uncharacterized protein with a bacterial SH3 domain homologue [Function unknown]
Probab=67.97  E-value=5.9  Score=30.71  Aligned_cols=21  Identities=24%  Similarity=0.180  Sum_probs=11.3

Q ss_pred             chhHHHHHHHHHHHHHHhhhH
Q 032762            2 GSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         2 ~sK~~llL~l~la~~LlvSSe   22 (134)
                      .|++.|+.++++.++|++++.
T Consensus         9 ~~~~~~~~A~a~~~~l~~~~~   29 (155)
T COG4991           9 LSMKTLMRASAFGLALLMPAA   29 (155)
T ss_pred             HhHHHHHHHHHHHHHHHhHHH
Confidence            455556666655555555443


No 20 
>PF02553 CbiN:  Cobalt transport protein component CbiN;  InterPro: IPR003705 The cobalt transport protein CbiN is part of the active cobalt transport system involved in uptake of cobalt in to the cell involved with cobalamin biosynthesis (vitamin B12). It has been suggested that CbiN may function as the periplasmic binding protein component of the active cobalt transport system [].; GO: 0015087 cobalt ion transmembrane transporter activity, 0006824 cobalt ion transport, 0009236 cobalamin biosynthetic process, 0016020 membrane
Probab=64.65  E-value=13  Score=25.47  Aligned_cols=10  Identities=20%  Similarity=0.292  Sum_probs=4.6

Q ss_pred             HHHHHHHHhc
Q 032762           23 AAARDLAETS   32 (134)
Q Consensus        23 vaArelaE~~   32 (134)
                      ..|++++++.
T Consensus        36 ~~A~~~I~~~   45 (74)
T PF02553_consen   36 DQAEEMIEEI   45 (74)
T ss_pred             HHHHHHHHHh
Confidence            3445555443


No 21 
>TIGR03045 PS_II_C550 cytochrome c-550. Members of this protein family are cytochrome c-550, the PsbV extrinsic protein of photosystem II, from both Cyanobacteria and chloroplasts. A paralog to this protein, PsbV2, is found in some species in addition to PsbV itself.
Probab=63.24  E-value=7.1  Score=30.18  Aligned_cols=25  Identities=32%  Similarity=0.432  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            9 LGLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         9 L~l~la~~LlvSSevaArelaE~~~   33 (134)
                      ++++|.++.++++.+.|.++.|++-
T Consensus         9 ~~~~~~~~~~~~~~~~a~~~~~~~~   33 (159)
T TIGR03045         9 LALLLLLIQLNVGPAQAAELDEETR   33 (159)
T ss_pred             HHHHHHHHHHccchHHHHhcccccc
Confidence            3444455556666676677666443


No 22 
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=62.68  E-value=7.1  Score=30.36  Aligned_cols=30  Identities=30%  Similarity=0.323  Sum_probs=17.0

Q ss_pred             hHHHHH--HHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            4 KVFLML--GLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         4 K~~llL--~l~la~~LlvSSevaArelaE~~~   33 (134)
                      |+|+++  +++|.+|.++.+.+.|.++.|++-
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~   34 (163)
T CHL00133          3 KKFSSLFLLVFLLIFSIFVSSALAIELDEATR   34 (163)
T ss_pred             HHHHHHHHHHHHHHHHHcccchhHhhccccce
Confidence            454443  333444455666677777777654


No 23 
>PRK13619 psbV cytochrome c-550; Provisional
Probab=62.39  E-value=6.8  Score=30.53  Aligned_cols=25  Identities=16%  Similarity=0.231  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            9 LGLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         9 L~l~la~~LlvSSevaArelaE~~~   33 (134)
                      ++++|++|.++++.+.|.++.|++-
T Consensus         9 ~~~~~~~~~~~~~~a~a~eld~~~~   33 (160)
T PRK13619          9 IATVFFFLQFQVNSANALELDEATR   33 (160)
T ss_pred             HHHHHHHHHHhccchhHhhccccce
Confidence            3444555555666677777766543


No 24 
>PRK10301 hypothetical protein; Provisional
Probab=62.22  E-value=10  Score=27.77  Aligned_cols=13  Identities=15%  Similarity=0.143  Sum_probs=5.3

Q ss_pred             HHHHhhhHHHHHH
Q 032762           15 IVLLISSEAAARD   27 (134)
Q Consensus        15 ~~LlvSSevaAre   27 (134)
                      +++++++.+.|-.
T Consensus        16 ~~~~~~~~A~AHa   28 (124)
T PRK10301         16 TTSLVTPAVWAHA   28 (124)
T ss_pred             HHHHhhhhhhhcc
Confidence            3334444443443


No 25 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=61.35  E-value=5.6  Score=32.24  Aligned_cols=13  Identities=23%  Similarity=0.391  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHhhh
Q 032762            9 LGLLVSIVLLISS   21 (134)
Q Consensus         9 L~l~la~~LlvSS   21 (134)
                      |+++++.+|||.+
T Consensus        26 LIiiva~~lf~~~   38 (217)
T PF07423_consen   26 LIIIVAYQLFFGG   38 (217)
T ss_pred             HHHHHhhhheecC
Confidence            4444455555533


No 26 
>PRK09125 DNA ligase; Provisional
Probab=60.75  E-value=3.9  Score=33.80  Aligned_cols=17  Identities=53%  Similarity=0.708  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHhhhHHHH
Q 032762            9 LGLLVSIVLLISSEAAA   25 (134)
Q Consensus         9 L~l~la~~LlvSSevaA   25 (134)
                      |+|+||++|+.||+-+|
T Consensus        10 ~~~~~~~~~~~~~~~~~   26 (282)
T PRK09125         10 LALLLALLLLASSANAA   26 (282)
T ss_pred             HHHHHHHHHhccccccC
Confidence            56667666666665444


No 27 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=59.31  E-value=13  Score=31.65  Aligned_cols=19  Identities=11%  Similarity=0.149  Sum_probs=15.7

Q ss_pred             HHHHhhhHHHHHHHHHhcc
Q 032762           15 IVLLISSEAAARDLAETSN   33 (134)
Q Consensus        15 ~~LlvSSevaArelaE~~~   33 (134)
                      +||.+.+.++|++++++++
T Consensus       238 aFV~F~~~e~A~~Ai~~ln  256 (346)
T TIGR01659       238 AFVRFNKREEAQEAISALN  256 (346)
T ss_pred             EEEEECCHHHHHHHHHHhC
Confidence            4678888888999998877


No 28 
>PRK13617 psbV cytochrome c-550; Provisional
Probab=58.15  E-value=7.1  Score=30.66  Aligned_cols=13  Identities=38%  Similarity=0.302  Sum_probs=6.9

Q ss_pred             hhhHHHHHHHHHh
Q 032762           19 ISSEAAARDLAET   31 (134)
Q Consensus        19 vSSevaArelaE~   31 (134)
                      +++.+.|.++.|+
T Consensus        27 ~~~~A~A~~ld~~   39 (170)
T PRK13617         27 ISSPAQAAQWDAE   39 (170)
T ss_pred             ccchhhhhhcccc
Confidence            4555555555554


No 29 
>PF02419 PsbL:  PsbL protein;  InterPro: IPR003372 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbL found in PSII. PsbL is located in a gene cluster with PsbE, PsbF and PsbJ (PsbEFJL). Both PsbL and PsbJ (IPR002682 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbL prevent the formation of both PSII core dimers and PSII-light harvesting complex []. In addition, both PsbL and PsbJ are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_L 3A0B_l 3ARC_l 1S5L_l 2AXT_l 3BZ2_L 4FBY_L 3PRQ_L 3PRR_L 3KZI_L ....
Probab=57.57  E-value=14  Score=22.13  Aligned_cols=15  Identities=33%  Similarity=0.344  Sum_probs=8.1

Q ss_pred             HHHHHHHHHHHHhhh
Q 032762            7 LMLGLLVSIVLLISS   21 (134)
Q Consensus         7 llL~l~la~~LlvSS   21 (134)
                      +-|.|++.+.||+||
T Consensus        19 ~GLllifvl~vLFss   33 (37)
T PF02419_consen   19 WGLLLIFVLAVLFSS   33 (37)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhh
Confidence            334445555566765


No 30 
>PRK15396 murein lipoprotein; Provisional
Probab=57.56  E-value=12  Score=25.73  Aligned_cols=19  Identities=16%  Similarity=0.314  Sum_probs=12.5

Q ss_pred             CchhHHHHHHHHHHHHHHh
Q 032762            1 MGSKVFLMLGLLVSIVLLI   19 (134)
Q Consensus         1 M~sK~~llL~l~la~~Llv   19 (134)
                      |..|++|+.+++|+++||.
T Consensus         1 m~~~kl~l~av~ls~~LLa   19 (78)
T PRK15396          1 MNRTKLVLGAVILGSTLLA   19 (78)
T ss_pred             CchhHHHHHHHHHHHHHHH
Confidence            6666777777766665554


No 31 
>TIGR02953 penta_MxKDx pentapeptide MXKDX repeat protein. Members of this protein family are small bacterial proteins, each with an N-terminal signal sequence followed by up to 11 imperfect repeats of a pentapeptide. The pentapeptide repeat usually follows the form Met-Xaa-Lys-Asp-Xaa.
Probab=56.27  E-value=12  Score=25.66  Aligned_cols=21  Identities=19%  Similarity=0.333  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHhhhHHHHHH
Q 032762            7 LMLGLLVSIVLLISSEAAARD   27 (134)
Q Consensus         7 llL~l~la~~LlvSSevaAre   27 (134)
                      |+++|+.++|++++..+.|++
T Consensus         3 i~~a~~aaal~~~a~~A~a~D   23 (75)
T TIGR02953         3 IVAAISAAAFLSLAPAALAQD   23 (75)
T ss_pred             HHHHHHHHHHHHHhHHhhhhh
Confidence            344444445555555555554


No 32 
>PF09403 FadA:  Adhesion protein FadA;  InterPro: IPR018543  FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. ; PDB: 3ETZ_B 3ETY_A 2GL2_B 3ETX_C 3ETW_A.
Probab=55.99  E-value=4.9  Score=30.00  Aligned_cols=19  Identities=26%  Similarity=0.482  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHhhhH
Q 032762            4 KVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSe   22 (134)
                      |++||+++++...+-+|++
T Consensus         2 KK~ll~~~lllss~sfaA~   20 (126)
T PF09403_consen    2 KKILLLGMLLLSSISFAAT   20 (126)
T ss_dssp             -------------------
T ss_pred             hHHHHHHHHHHHHHHHHcc
Confidence            4555554444344444443


No 33 
>PRK13620 psbV cytochrome c-550; Provisional
Probab=55.02  E-value=10  Score=30.80  Aligned_cols=24  Identities=17%  Similarity=0.256  Sum_probs=13.5

Q ss_pred             HHHHHHHHHhhhHHHHHHHHHhcc
Q 032762           10 GLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus        10 ~l~la~~LlvSSevaArelaE~~~   33 (134)
                      +++|.+|.++++.+.|.++.|++-
T Consensus        63 ~~~~~~~~~~~~~a~A~~ld~~tr   86 (215)
T PRK13620         63 AALLAVFQFNLGAAQAAELTAETR   86 (215)
T ss_pred             HHHHHHHHhccchhhHHHhhccce
Confidence            344444555566666777766543


No 34 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=54.79  E-value=6.1  Score=29.18  Aligned_cols=9  Identities=44%  Similarity=0.449  Sum_probs=3.6

Q ss_pred             hHHHHHHHH
Q 032762            4 KVFLMLGLL   12 (134)
Q Consensus         4 K~~llL~l~   12 (134)
                      |++|+++++
T Consensus         2 ~~~~~~~~~   10 (162)
T PF12276_consen    2 KRRLLLALA   10 (162)
T ss_pred             chHHHHHHH
Confidence            334444333


No 35 
>COG3354 FlaG Putative archaeal flagellar protein G [Cell motility and secretion]
Probab=53.31  E-value=14  Score=28.52  Aligned_cols=21  Identities=24%  Similarity=0.295  Sum_probs=13.0

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |||-+.--|++|+|++|..+|
T Consensus         1 mAs~a~SeLV~FIaalLiaas   21 (154)
T COG3354           1 MASVASSELVMFIAALLIAAS   21 (154)
T ss_pred             CCccchhHHHHHHHHHHHHHH
Confidence            888776666676655444333


No 36 
>PF06411 HdeA:  HdeA/HdeB family;  InterPro: IPR010486 HNS (histone-like nucleoid structuring)-dependent expression A (HdeA) protein is a stress response protein found in highly acid resistant bacteria such as Shigella flexneri and Escherichia coli, but which is lacking in mildly acid tolerant bacteria such as Salmonella []. HdeA is one of the most abundant proteins found in the periplasmic space of E. coli, where it is one of a network of proteins that confer an acid resistance phenotype essential for the pathogenesis of enteric bacteria []. HdeA is thought to act as a chaperone, functioning to prevent the aggregation of periplasmic proteins denatured under acidic conditions. The HNS protein, a chromatin-associated protein that influences the gene expression of several environmentally-induced target genes, represses the expression of HdeA. HdeB, which is encoded within the same operon, may form heterodimers with HdeA. HdeA is a single domain protein with an overall fold that is similar to the fold of the N-terminal subdomain of the GluRS anticodon-binding domain. ; PDB: 1BG8_C 1DJ8_C 2XUV_C.
Probab=52.78  E-value=4.6  Score=27.97  Aligned_cols=17  Identities=29%  Similarity=0.401  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHhh
Q 032762            4 KVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         4 K~~llL~l~la~~LlvS   20 (134)
                      |++++++++|+++.+++
T Consensus         1 ~~~~~~~~~l~~~~~~~   17 (94)
T PF06411_consen    1 KKLVLLILALALAALAS   17 (94)
T ss_dssp             -----------------
T ss_pred             ChHHHHHHHHHHHHHHH
Confidence            55555555544444443


No 37 
>PLN03207 stomagen; Provisional
Probab=52.16  E-value=13  Score=27.13  Aligned_cols=8  Identities=13%  Similarity=0.015  Sum_probs=4.5

Q ss_pred             CccCCCCc
Q 032762          113 GCRCCSYA  120 (134)
Q Consensus       113 c~rcc~~~  120 (134)
                      |++=|+..
T Consensus        84 cr~kc~~e   91 (113)
T PLN03207         84 CRYKCRAE   91 (113)
T ss_pred             ccccccce
Confidence            66556543


No 38 
>PF10690 Myticin-prepro:  Myticin pre-proprotein from the mussel;  InterPro: IPR019631  Myticin is a cysteine-rich peptide produced in three isoforms, A, B and C, by Mytilus galloprovincialis (Mediterranean mussel). Isoforms A and B show antibacterial activity against Gram-positive bacteria, while isoform B is additionally active against the fungus Fusarium oxysporum and a Gram-negative bacterium, Escherichia coli (streptomycin resistant strain D31) []. Myticin-prepro is the precursor peptide. The mature molecule, named myticin, consists of 40 residues, with four intramolecular disulphide bridges and a cysteine array in the primary structure different from that of previously characterised cysteine-rich antimicrobial peptides. The first 20 amino acids are a putative signal peptide, and the antimicrobial peptide sequence is a 36-residue C-terminal extension. Such a structure suggests that myticins are synthesised as prepro-proteins that are then processed by various proteolytic events before storage in the haemocytes as the active peptide. Myticin precursors are expressed mainly in the haemocytes. ; PDB: 2EEM_A.
Probab=51.99  E-value=4.8  Score=28.88  Aligned_cols=16  Identities=19%  Similarity=0.542  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHh
Q 032762            4 KVFLMLGLLVSIVLLI   19 (134)
Q Consensus         4 K~~llL~l~la~~Llv   19 (134)
                      |+-+||++++|.||.+
T Consensus         2 KatIlLAv~vAViv~v   17 (98)
T PF10690_consen    2 KATILLAVVVAVIVGV   17 (98)
T ss_dssp             ----------------
T ss_pred             cccccccccccccccc
Confidence            7778888888776644


No 39 
>PRK10772 cell division protein FtsL; Provisional
Probab=51.32  E-value=24  Score=25.71  Aligned_cols=26  Identities=19%  Similarity=0.376  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHhhhHHHHHHHHHhcc
Q 032762            8 MLGLLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus         8 lL~l~la~~LlvSSevaArelaE~~~   33 (134)
                      ++++++.++.+|.+...+|.+..+.+
T Consensus        30 l~~vv~SAl~VV~~~h~tR~l~~ele   55 (108)
T PRK10772         30 FIAVIVSAVTVVTTAHHTRLLTAERE   55 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444555556666667777766554


No 40 
>PRK13618 psbV cytochrome c-550; Provisional
Probab=51.11  E-value=18  Score=28.12  Aligned_cols=13  Identities=31%  Similarity=0.458  Sum_probs=6.5

Q ss_pred             hHHHHHHHHHhcc
Q 032762           21 SEAAARDLAETSN   33 (134)
Q Consensus        21 SevaArelaE~~~   33 (134)
                      +.+.|.++.|++.
T Consensus        22 ~~a~A~~~d~~t~   34 (163)
T PRK13618         22 GSATAAELDEATR   34 (163)
T ss_pred             cHHHHhhcccccc
Confidence            3444555555543


No 41 
>PF10749 DUF2534:  Protein of unknown function (DUF2534);  InterPro: IPR019685  This entry represents proteins with unknown function, and appear to be restricted to Enterobacteriaceae. 
Probab=50.32  E-value=32  Score=24.20  Aligned_cols=21  Identities=29%  Similarity=0.477  Sum_probs=10.6

Q ss_pred             hhHHHH-HHHHHHHHHHhhhHH
Q 032762            3 SKVFLM-LGLLVSIVLLISSEA   23 (134)
Q Consensus         3 sK~~ll-L~l~la~~LlvSSev   23 (134)
                      .|+||+ |+.++++++.+.+.+
T Consensus        12 ~kkFl~~l~~vfiia~~Vv~rA   33 (85)
T PF10749_consen   12 GKKFLLALAIVFIIAATVVGRA   33 (85)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Confidence            356665 444444445454443


No 42 
>PLN03161 Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional
Probab=48.94  E-value=11  Score=31.78  Aligned_cols=21  Identities=24%  Similarity=0.306  Sum_probs=12.6

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |||-+-|||+||++++++-.|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~   21 (291)
T PLN03161          1 MASLKTLLVALFAALAAFDRS   21 (291)
T ss_pred             ChhHHHHHHHHHHHHHhcCCC
Confidence            888655666666555554333


No 43 
>COG2869 NqrC Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC [Energy production and conversion]
Probab=48.79  E-value=8.8  Score=31.96  Aligned_cols=18  Identities=17%  Similarity=0.340  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHhhhHH
Q 032762            6 FLMLGLLVSIVLLISSEA   23 (134)
Q Consensus         6 ~llL~l~la~~LlvSSev   23 (134)
                      +++|+|.|++-+++|..+
T Consensus        15 lvvl~lsLvcsvivagaa   32 (264)
T COG2869          15 LVVLVLSLVCSVIVAGAA   32 (264)
T ss_pred             hhHHHHHHHHHHHHhhhh
Confidence            444666655555665543


No 44 
>TIGR01495 ETRAMP Plasmodium ring stage membrane protein ETRAMP. These genes have been shown to be found in the sub-telomeric regions of both P. falciparum and P. yoelii chromosomes.
Probab=48.64  E-value=14  Score=25.76  Aligned_cols=18  Identities=22%  Similarity=0.491  Sum_probs=14.1

Q ss_pred             hhHHHHHHHHHHHHHHhh
Q 032762            3 SKVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         3 sK~~llL~l~la~~LlvS   20 (134)
                      ||.|++++++|++-|++.
T Consensus         4 sKi~~f~~~Ll~in~~~p   21 (85)
T TIGR01495         4 SKILYFFAALLAINFIAP   21 (85)
T ss_pred             hHHHHHHHHHHHHHhCcc
Confidence            788999988888866653


No 45 
>TIGR02209 ftsL_broad cell division protein FtsL. This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the Pfam model pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species.
Probab=47.58  E-value=41  Score=22.12  Aligned_cols=11  Identities=9%  Similarity=0.295  Sum_probs=4.6

Q ss_pred             HHHHhhhHHHH
Q 032762           15 IVLLISSEAAA   25 (134)
Q Consensus        15 ~~LlvSSevaA   25 (134)
                      +|.++++....
T Consensus        16 ~~~~v~~~~~~   26 (85)
T TIGR02209        16 AISVVSAQHQT   26 (85)
T ss_pred             HHHHHHHHHHH
Confidence            33344444433


No 46 
>COG2854 Ttg2D ABC-type transport system involved in resistance to organic solvents, auxiliary component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=47.50  E-value=8.7  Score=30.94  Aligned_cols=20  Identities=30%  Similarity=0.210  Sum_probs=10.5

Q ss_pred             CchhHHHHHHHHHHHHHHhh
Q 032762            1 MGSKVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvS   20 (134)
                      |--|.|+.+.|++++|+..+
T Consensus         2 ~m~k~l~~~~ll~~a~a~~~   21 (202)
T COG2854           2 MMKKSLTILALLVIAFASSL   21 (202)
T ss_pred             hHHHHHHHHHHHHHHHHHHH
Confidence            33456666666555544333


No 47 
>PRK15240 resistance to complement killing; Provisional
Probab=47.41  E-value=12  Score=29.20  Aligned_cols=16  Identities=31%  Similarity=0.324  Sum_probs=7.0

Q ss_pred             hHHHHHHHHHHHHHHh
Q 032762            4 KVFLMLGLLVSIVLLI   19 (134)
Q Consensus         4 K~~llL~l~la~~Llv   19 (134)
                      |+.|+++++++++++.
T Consensus         2 kk~~~~~~~~~~~~~~   17 (185)
T PRK15240          2 KKIVLSSLLLSAAGLA   17 (185)
T ss_pred             chhHHHHHHHHHHHhc
Confidence            4555544443333333


No 48 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=47.17  E-value=16  Score=23.47  Aligned_cols=12  Identities=42%  Similarity=0.551  Sum_probs=5.4

Q ss_pred             HHhhhHHHHHHH
Q 032762           17 LLISSEAAARDL   28 (134)
Q Consensus        17 LlvSSevaArel   28 (134)
                      ||++--+.|+++
T Consensus        11 LLlAlqaQAepl   22 (52)
T PF00879_consen   11 LLLALQAQAEPL   22 (52)
T ss_pred             HHHHHHHhcccc
Confidence            444444445544


No 49 
>COG3495 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.47  E-value=14  Score=28.67  Aligned_cols=21  Identities=29%  Similarity=0.357  Sum_probs=10.1

Q ss_pred             hHHHHHHHHHHHHHHhhhHHH
Q 032762            4 KVFLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSeva   24 (134)
                      |.|+++.+|++++||.++-++
T Consensus         2 ~rf~~i~lL~~A~lls~plva   22 (166)
T COG3495           2 NRFTSITLLAAALLLSAPLVA   22 (166)
T ss_pred             chhHHHHHHHHHHHhcchhhh
Confidence            456665554444344444333


No 50 
>PF03823 Neurokinin_B:  Neurokinin B;  InterPro: IPR003635 Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. This family includes neurokinins, as well as many other peptides. Like other tachykinins, neurokinins are synthesized as larger protein precursors that are enzymatically converted to their mature forms.; GO: 0007217 tachykinin receptor signaling pathway
Probab=45.30  E-value=33  Score=22.48  Aligned_cols=14  Identities=21%  Similarity=0.434  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHHhh
Q 032762            7 LMLGLLVSIVLLIS   20 (134)
Q Consensus         7 llL~l~la~~LlvS   20 (134)
                      |||+.+||+.|.-|
T Consensus         5 lLf~aiLalsla~s   18 (59)
T PF03823_consen    5 LLFAAILALSLARS   18 (59)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33333344433333


No 51 
>PF12048 DUF3530:  Protein of unknown function (DUF3530);  InterPro: IPR022529  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 272 to 336 amino acids in length. These proteins are distantly related to alpa/beta hydrolases so they may act as enzymes. 
Probab=45.01  E-value=20  Score=29.86  Aligned_cols=22  Identities=36%  Similarity=0.439  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHhhhHHHHH
Q 032762            5 VFLMLGLLVSIVLLISSEAAAR   26 (134)
Q Consensus         5 ~~llL~l~la~~LlvSSevaAr   26 (134)
                      .|+|+.++|+.++++++.++++
T Consensus         4 ~~~l~~~~l~~~~~~~~~~~~~   25 (310)
T PF12048_consen    4 RFLLPLLFLSSILAAAAQAAAA   25 (310)
T ss_pred             HHHHHHHHHHHHHHhhchhhcc
Confidence            3444445555555555555443


No 52 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=44.75  E-value=33  Score=28.08  Aligned_cols=16  Identities=19%  Similarity=0.355  Sum_probs=9.2

Q ss_pred             HHHHhhhHHHHHHHHH
Q 032762           15 IVLLISSEAAARDLAE   30 (134)
Q Consensus        15 ~~LlvSSevaArelaE   30 (134)
                      .||++|.-|.|..+..
T Consensus       145 T~LfLSTVVLANKVS~  160 (227)
T PF05399_consen  145 TLLFLSTVVLANKVSS  160 (227)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3566666666655543


No 53 
>KOG4087 consensus Phospholipase A2 [Lipid transport and metabolism]
Probab=44.03  E-value=64  Score=24.76  Aligned_cols=30  Identities=27%  Similarity=0.442  Sum_probs=13.1

Q ss_pred             hHHHHHHHHHHHHHHhhh--HHHHHHHHHhcc
Q 032762            4 KVFLMLGLLVSIVLLISS--EAAARDLAETSN   33 (134)
Q Consensus         4 K~~llL~l~la~~LlvSS--evaArelaE~~~   33 (134)
                      |.+|+|++|+...|+...  -..-++++|.++
T Consensus         2 k~~~~la~l~~~~~~~~~g~l~~l~~Mi~~vt   33 (144)
T KOG4087|consen    2 KLLLLLAFLLPAVLLTAHGALLNLKKMIECVT   33 (144)
T ss_pred             chhHHHHHHHHHHHhhcchHHHHHHHHHHHHc
Confidence            455556555444333321  122344555443


No 54 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=44.02  E-value=32  Score=21.39  Aligned_cols=12  Identities=25%  Similarity=0.268  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHhh
Q 032762            9 LGLLVSIVLLIS   20 (134)
Q Consensus         9 L~l~la~~LlvS   20 (134)
                      ++|+|++|||.+
T Consensus        10 ~~vll~s~llaa   21 (44)
T COG5510          10 ALVLLASTLLAA   21 (44)
T ss_pred             HHHHHHHHHHHH
Confidence            444444555443


No 55 
>PF12092 DUF3568:  Protein of unknown function (DUF3568);  InterPro: IPR021952  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 130 amino acids in length. 
Probab=43.77  E-value=17  Score=27.18  Aligned_cols=14  Identities=29%  Similarity=0.543  Sum_probs=6.3

Q ss_pred             hHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVL   17 (134)
Q Consensus         4 K~~llL~l~la~~L   17 (134)
                      |++|++.|++++.|
T Consensus         1 kkl~~~~l~~~~~l   14 (131)
T PF12092_consen    1 KKLLLIALFILSTL   14 (131)
T ss_pred             CccHHHHHHHHHHH
Confidence            45555544433333


No 56 
>PRK10894 lipopolysaccharide transport periplasmic protein LptA; Provisional
Probab=42.94  E-value=20  Score=27.53  Aligned_cols=10  Identities=40%  Similarity=0.218  Sum_probs=3.9

Q ss_pred             HHHHHhhhHH
Q 032762           14 SIVLLISSEA   23 (134)
Q Consensus        14 a~~LlvSSev   23 (134)
                      +++|+++..+
T Consensus        12 ~~ll~~~~~a   21 (180)
T PRK10894         12 SSLLAASIPA   21 (180)
T ss_pred             HHHHHHHHHH
Confidence            3334444333


No 57 
>PHA03255 BDLF3; Provisional
Probab=42.36  E-value=21  Score=28.70  Aligned_cols=14  Identities=43%  Similarity=0.667  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHHHh
Q 032762            6 FLMLGLLVSIVLLI   19 (134)
Q Consensus         6 ~llL~l~la~~Llv   19 (134)
                      ||+|+|+||+=++|
T Consensus       194 flmlilifaagimm  207 (234)
T PHA03255        194 FLMLILIFAAGLMM  207 (234)
T ss_pred             HHHHHHHHHhhHhh
Confidence            33344444443333


No 58 
>PF07438 DUF1514:  Protein of unknown function (DUF1514);  InterPro: IPR009999 This entry is represented by Bacteriophage phi PVL, Orf60. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several Staphylococcus aureus and related bacteriophage proteins of around 65 residues in length. The function of this family is unknown.
Probab=41.89  E-value=40  Score=22.63  Aligned_cols=14  Identities=36%  Similarity=0.700  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHhhh
Q 032762            8 MLGLLVSIVLLISS   21 (134)
Q Consensus         8 lL~l~la~~LlvSS   21 (134)
                      .+.++||++|||+-
T Consensus         4 iiSIvLai~lLI~l   17 (66)
T PF07438_consen    4 IISIVLAIALLISL   17 (66)
T ss_pred             hHHHHHHHHHHHHH
Confidence            34444555555443


No 59 
>PF05513 TraA:  TraA;  InterPro: IPR008873 Conjugative transfer of a bacteriocin plasmid, pPD1, of Enterococcus faecalis is induced in response to a peptide sex pheromone, cPD1, secreted from plasmid-free recipient cells. cPD1 is taken up by a pPD1 donor cell and binds to an intracellular receptor, TraA. Once a recipient cell acquires pPD1, it starts to produce an inhibitor of cPD1, termed iPD1, which functions as a TraA antagonist and blocks self-induction in donor cells. TraA transduces the signal of cPD1 to the mating response [].; GO: 0000746 conjugation, 0005576 extracellular region
Probab=41.61  E-value=34  Score=25.45  Aligned_cols=23  Identities=26%  Similarity=0.378  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHhhhHHHHHHHHHh
Q 032762            9 LGLLVSIVLLISSEAAARDLAET   31 (134)
Q Consensus         9 L~l~la~~LlvSSevaArelaE~   31 (134)
                      .+++++++++++..+.|.|+-..
T Consensus        39 ~av~~l~~~~~~~~A~A~DLlA~   61 (119)
T PF05513_consen   39 VAVLALFFLALAHPAHATDLLAS   61 (119)
T ss_pred             HHHHHHHHHhhhhhhhhHHHHhc
Confidence            34443344455555556665443


No 60 
>PF12869 tRNA_anti-like:  tRNA_anti-like;  InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [].; PDB: 3F1Z_I.
Probab=41.24  E-value=10  Score=27.31  Aligned_cols=9  Identities=33%  Similarity=0.479  Sum_probs=0.0

Q ss_pred             Cc-hhHHHHH
Q 032762            1 MG-SKVFLML    9 (134)
Q Consensus         1 M~-sK~~llL    9 (134)
                      |- .|++|++
T Consensus         1 M~~~kk~l~~   10 (144)
T PF12869_consen    1 MKILKKILII   10 (144)
T ss_dssp             ----------
T ss_pred             CchhhhHHHH
Confidence            54 4555443


No 61 
>PRK09810 entericidin A; Provisional
Probab=41.23  E-value=33  Score=20.96  Aligned_cols=8  Identities=38%  Similarity=0.513  Sum_probs=3.7

Q ss_pred             hHHHHHHH
Q 032762            4 KVFLMLGL   11 (134)
Q Consensus         4 K~~llL~l   11 (134)
                      |++++|++
T Consensus         3 kk~~~l~~   10 (41)
T PRK09810          3 KRLIVLVL   10 (41)
T ss_pred             HHHHHHHH
Confidence            45444443


No 62 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=41.16  E-value=47  Score=24.30  Aligned_cols=20  Identities=15%  Similarity=0.579  Sum_probs=11.4

Q ss_pred             CchhHHHHHHHHHHHHHHhh
Q 032762            1 MGSKVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvS   20 (134)
                      |.--.+|+|+++|++|.|+.
T Consensus         1 ~~~~~il~~vv~~~i~yf~i   20 (113)
T PRK06531          1 MGIPTIIMFVVMLGLIFFMQ   20 (113)
T ss_pred             CchHHHHHHHHHHHHHHhee
Confidence            44444555666666666554


No 63 
>PF12097 DUF3573:  Protein of unknown function (DUF3573);  InterPro: IPR021956  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 372 to 530 amino acids in length. 
Probab=41.11  E-value=18  Score=31.60  Aligned_cols=21  Identities=33%  Similarity=0.395  Sum_probs=14.4

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |=.|++|++..||++.++..+
T Consensus         1 ~~~k~~li~~~ll~~~~~~~~   21 (383)
T PF12097_consen    1 MFKKTCLILSFLLAISILAFF   21 (383)
T ss_pred             CcccchhhHHHHHHHHHHHhc
Confidence            667888888777766555433


No 64 
>PRK10260 L,D-transpeptidase; Provisional
Probab=41.07  E-value=18  Score=30.84  Aligned_cols=24  Identities=21%  Similarity=0.243  Sum_probs=14.9

Q ss_pred             CchhHHHHHHHHHHHHHHhhhHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSEAAA   25 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSevaA   25 (134)
                      |-.|.++++.|+|++ +++++.+.|
T Consensus         1 ~~~~~~~~~~~~~~~-~~~~~~~~A   24 (306)
T PRK10260          1 MNMKLKTLFAAAFAV-VGFCSTASA   24 (306)
T ss_pred             CcchhhHHHHHHHHH-HHhccchhh
Confidence            777887777777744 445444443


No 65 
>PF04885 Stig1:  Stigma-specific protein, Stig1;  InterPro: IPR006969 This family represents the Stig1 cysteine rich plant protein.The tobacco stigma-specific gene, STIG1 is developmentally regulated and expressed specifically in the stigmatic secretory zone. Pistils of transgenic STIG1-barnase tobacco plants undergo normal development, but lack the stigmatic secretory zone and are female sterile. Pollen grains are unable to penetrate the surface of the ablated pistils. Application of stigmatic exudate from wild-type pistils to the ablated surface increases the efficiency of pollen tube germination and growth and restores the capacity of pollen tubes to penetrate the style []. The function of STIG1 is unknown.
Probab=41.04  E-value=8.6  Score=29.05  Aligned_cols=15  Identities=27%  Similarity=0.565  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHHHhhh
Q 032762            7 LMLGLLVSIVLLISS   21 (134)
Q Consensus         7 llL~l~la~~LlvSS   21 (134)
                      |||+|+|++++.+++
T Consensus         3 ill~l~lt~~~~~~~   17 (136)
T PF04885_consen    3 ILLVLVLTLITISSS   17 (136)
T ss_pred             eHHHHHHHHHHHhcc
Confidence            344444444333333


No 66 
>PF12477 TraW_N:  Sex factor F TraW protein N terminal
Probab=40.98  E-value=15  Score=21.08  Aligned_cols=13  Identities=46%  Similarity=0.667  Sum_probs=6.2

Q ss_pred             HHHHhhhHHHHHH
Q 032762           15 IVLLISSEAAARD   27 (134)
Q Consensus        15 ~~LlvSSevaAre   27 (134)
                      ++++++..+.|++
T Consensus         8 ~~~~~~~~a~Akd   20 (31)
T PF12477_consen    8 ALLLLSPSAHAKD   20 (31)
T ss_pred             HHHHcCcccchhh
Confidence            3445554444444


No 67 
>PRK10318 hypothetical protein; Provisional
Probab=40.59  E-value=31  Score=25.75  Aligned_cols=11  Identities=27%  Similarity=0.543  Sum_probs=4.6

Q ss_pred             HHHHHHHHHHH
Q 032762            7 LMLGLLVSIVL   17 (134)
Q Consensus         7 llL~l~la~~L   17 (134)
                      +|+.|||+..+
T Consensus         6 ~l~~lL~~~~~   16 (121)
T PRK10318          6 LLITLLFTLPA   16 (121)
T ss_pred             HHHHHHHHHHH
Confidence            33444444433


No 68 
>TIGR00547 lolA periplasmic chaperone LolA. This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself.
Probab=40.00  E-value=38  Score=26.67  Aligned_cols=6  Identities=0%  Similarity=-0.169  Sum_probs=2.3

Q ss_pred             HHHHHH
Q 032762            6 FLMLGL   11 (134)
Q Consensus         6 ~llL~l   11 (134)
                      +++|+|
T Consensus         5 ~~~~~l   10 (204)
T TIGR00547         5 AIKCAA   10 (204)
T ss_pred             HHHHHH
Confidence            333433


No 69 
>PRK09455 rseB anti-sigma E factor; Provisional
Probab=39.80  E-value=15  Score=31.11  Aligned_cols=21  Identities=29%  Similarity=0.264  Sum_probs=11.6

Q ss_pred             hHHHHHHHHHHHHHHhhhHHH
Q 032762            4 KVFLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSeva   24 (134)
                      |++++++++|++.|++++.++
T Consensus         2 ~~~~~~~~~l~~~l~~~~~~~   22 (319)
T PRK09455          2 KQLWFAVSLLTGSLLFSANAS   22 (319)
T ss_pred             chHHHHHHHHHHhhccccccc
Confidence            566665555555555555444


No 70 
>PLN00212 glutelin; Provisional
Probab=39.77  E-value=28  Score=31.50  Aligned_cols=20  Identities=15%  Similarity=0.223  Sum_probs=10.9

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |+|+++|| .|.|+++||+.+
T Consensus         1 ~~~~~~~l-~~~~~~l~l~~~   20 (493)
T PLN00212          1 ASSAFSRL-SICFCVLLLCHG   20 (493)
T ss_pred             CcchHHHH-HHHHHHHHHHhh
Confidence            77766554 334445555544


No 71 
>COG3017 LolB Outer membrane lipoprotein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane]
Probab=39.73  E-value=19  Score=29.17  Aligned_cols=21  Identities=29%  Similarity=0.282  Sum_probs=15.1

Q ss_pred             chhHHHHHHHHHHHHHHhhhH
Q 032762            2 GSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         2 ~sK~~llL~l~la~~LlvSSe   22 (134)
                      -+|++++|.+.+|+|||.+..
T Consensus         3 ~~~~~~~~l~~~As~LL~aC~   23 (206)
T COG3017           3 MMKRLLFLLLALASLLLTACT   23 (206)
T ss_pred             hHHHHHHHHHHHHHHHHHhcc
Confidence            367777777777888887663


No 72 
>PF06796 NapE:  Periplasmic nitrate reductase protein NapE;  InterPro: IPR010649 This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides. NapE is thought to be a transmembrane protein [].
Probab=39.57  E-value=35  Score=22.17  Aligned_cols=15  Identities=33%  Similarity=0.585  Sum_probs=7.9

Q ss_pred             hHHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLL   18 (134)
Q Consensus         4 K~~llL~l~la~~Ll   18 (134)
                      |+||+|+++|.=+|.
T Consensus        19 ~~flfl~~~l~PiL~   33 (56)
T PF06796_consen   19 KAFLFLAVVLFPILA   33 (56)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            456666555444443


No 73 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=39.36  E-value=25  Score=26.90  Aligned_cols=15  Identities=27%  Similarity=0.503  Sum_probs=6.3

Q ss_pred             hHHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLL   18 (134)
Q Consensus         4 K~~llL~l~la~~Ll   18 (134)
                      |-|++|+|||.+|+.
T Consensus         2 Kll~~lilli~~~~~   16 (212)
T PF11912_consen    2 KLLISLILLILLIIN   16 (212)
T ss_pred             cHHHHHHHHHHHHHh
Confidence            544444444333333


No 74 
>PLN03024 Putative EG45-like domain containing protein 1; Provisional
Probab=38.42  E-value=19  Score=26.63  Aligned_cols=9  Identities=33%  Similarity=0.364  Sum_probs=4.4

Q ss_pred             chhHHHHHH
Q 032762            2 GSKVFLMLG   10 (134)
Q Consensus         2 ~sK~~llL~   10 (134)
                      -||++|++.
T Consensus         1 ~~~~~~~~~    9 (125)
T PLN03024          1 MSKRILIFS    9 (125)
T ss_pred             CceeeHHHH
Confidence            066655443


No 75 
>PRK00753 psbL photosystem II reaction center L; Provisional
Probab=38.39  E-value=36  Score=20.56  Aligned_cols=11  Identities=36%  Similarity=0.504  Sum_probs=5.5

Q ss_pred             HHHHHHHHhhh
Q 032762           11 LLVSIVLLISS   21 (134)
Q Consensus        11 l~la~~LlvSS   21 (134)
                      |++++.|++||
T Consensus        25 lifvl~vLFss   35 (39)
T PRK00753         25 LVFVLGILFSS   35 (39)
T ss_pred             HHHHHHHHHHh
Confidence            33344556664


No 76 
>PF12930 DUF3836:  Family of unknown function (DUF3836);  InterPro: IPR024339 This entry represents a family of bacterial proteins of unknown function.; PDB: 3MSW_A.
Probab=37.96  E-value=9.2  Score=28.55  Aligned_cols=12  Identities=8%  Similarity=0.257  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSI   15 (134)
Q Consensus         4 K~~llL~l~la~   15 (134)
                      |+++|++++|++
T Consensus         8 K~~v~~av~~~s   19 (132)
T PF12930_consen    8 KALVLSAVVAVS   19 (132)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            555555544433


No 77 
>PF14060 DUF4252:  Domain of unknown function (DUF4252)
Probab=37.52  E-value=54  Score=23.84  Aligned_cols=8  Identities=25%  Similarity=0.438  Sum_probs=3.7

Q ss_pred             hHHHHHHH
Q 032762            4 KVFLMLGL   11 (134)
Q Consensus         4 K~~llL~l   11 (134)
                      |++|++.+
T Consensus         1 Kk~i~~l~    8 (155)
T PF14060_consen    1 KKIILILL    8 (155)
T ss_pred             ChhHHHHH
Confidence            45444433


No 78 
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=36.90  E-value=31  Score=26.67  Aligned_cols=14  Identities=7%  Similarity=0.408  Sum_probs=7.6

Q ss_pred             hhHHHHHHHHHHHH
Q 032762            3 SKVFLMLGLLVSIV   16 (134)
Q Consensus         3 sK~~llL~l~la~~   16 (134)
                      .|+|+|++++++++
T Consensus         4 ~kkl~~~~v~~~l~   17 (170)
T PRK12750          4 AKKLVLAAVVLPLT   17 (170)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35666665554443


No 79 
>PF14147 Spore_YhaL:  Sporulation protein YhaL
Probab=36.72  E-value=74  Score=20.43  Aligned_cols=17  Identities=18%  Similarity=0.497  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHhhhH
Q 032762            6 FLMLGLLVSIVLLISSE   22 (134)
Q Consensus         6 ~llL~l~la~~LlvSSe   22 (134)
                      |++++++|+++.++-+.
T Consensus         7 ~vi~gI~~S~ym~v~t~   23 (52)
T PF14147_consen    7 FVIAGIIFSGYMAVKTA   23 (52)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44566666666666543


No 80 
>COG4856 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.65  E-value=23  Score=31.32  Aligned_cols=19  Identities=16%  Similarity=0.417  Sum_probs=12.2

Q ss_pred             chhHHHHH-HHHHHHHHHhh
Q 032762            2 GSKVFLML-GLLVSIVLLIS   20 (134)
Q Consensus         2 ~sK~~llL-~l~la~~LlvS   20 (134)
                      .|||++.+ +||||++|+++
T Consensus         6 ns~W~irIiaff~A~~Lfl~   25 (403)
T COG4856           6 NSPWLIRIIAFFFAILLFLY   25 (403)
T ss_pred             cCcHhHHHHHHHHHHHhhee
Confidence            36777665 57777766554


No 81 
>PRK15307 major fimbrial protein StkA; Provisional
Probab=36.44  E-value=30  Score=26.91  Aligned_cols=15  Identities=13%  Similarity=0.002  Sum_probs=8.4

Q ss_pred             CchhHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSI   15 (134)
Q Consensus         1 M~sK~~llL~l~la~   15 (134)
                      |-.|+++|+++++++
T Consensus         1 m~~~~~~l~~~~~~~   15 (201)
T PRK15307          1 MFLKKYGLAAAVAMT   15 (201)
T ss_pred             CchHHHHHHHHHHHH
Confidence            766766655554433


No 82 
>PRK10780 periplasmic chaperone; Provisional
Probab=35.94  E-value=43  Score=25.22  Aligned_cols=6  Identities=33%  Similarity=0.595  Sum_probs=3.0

Q ss_pred             hHHHHH
Q 032762            4 KVFLML    9 (134)
Q Consensus         4 K~~llL    9 (134)
                      |+||++
T Consensus         2 kk~~~~    7 (165)
T PRK10780          2 KKWLLA    7 (165)
T ss_pred             hHHHHH
Confidence            555543


No 83 
>PLN00213 predicted protein; Provisional
Probab=35.81  E-value=29  Score=25.80  Aligned_cols=19  Identities=21%  Similarity=0.366  Sum_probs=12.2

Q ss_pred             CchhHHHHHHHHHHHHHHh
Q 032762            1 MGSKVFLMLGLLVSIVLLI   19 (134)
Q Consensus         1 M~sK~~llL~l~la~~Llv   19 (134)
                      |.-|..++|.+++.++|.|
T Consensus         1 m~iknV~~ll~v~cIvvsV   19 (118)
T PLN00213          1 MSIKNVFLLLAVLCIIVSV   19 (118)
T ss_pred             CchHHHHHHHHHHHHHhee
Confidence            7778877766655554443


No 84 
>PRK13881 conjugal transfer protein TrbI; Provisional
Probab=35.72  E-value=50  Score=29.86  Aligned_cols=20  Identities=20%  Similarity=0.192  Sum_probs=9.3

Q ss_pred             HHHHHHhhhHHHHHHHHHhc
Q 032762           13 VSIVLLISSEAAARDLAETS   32 (134)
Q Consensus        13 la~~LlvSSevaArelaE~~   32 (134)
                      |.+|||+..-|+|+.++++.
T Consensus        38 ~~~f~~~~~~va~~r~~~~~   57 (472)
T PRK13881         38 LLSFVLVMALVAADRAAKQN   57 (472)
T ss_pred             HHHHHHHHHHHHHHHHHhcC
Confidence            33444444445555444443


No 85 
>COG4890 Predicted outer membrane lipoprotein [Function unknown]
Probab=35.60  E-value=75  Score=18.92  Aligned_cols=24  Identities=25%  Similarity=0.282  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHhhhHHHHHHHHHhc
Q 032762            8 MLGLLVSIVLLISSEAAARDLAETS   32 (134)
Q Consensus         8 lL~l~la~~LlvSSevaArelaE~~   32 (134)
                      +|.++||.++-|..+. .-|..|..
T Consensus         7 iLG~lLAcAFgiinAl-wlEh~e~~   30 (37)
T COG4890           7 ILGLLLACAFGIINAL-WLEHMEDR   30 (37)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHH
Confidence            4677777766665433 34444443


No 86 
>TIGR02972 TMAO_torE trimethylamine N-oxide reductase system, TorE protein. Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA.
Probab=35.54  E-value=46  Score=20.94  Aligned_cols=14  Identities=14%  Similarity=0.190  Sum_probs=7.8

Q ss_pred             hHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVL   17 (134)
Q Consensus         4 K~~llL~l~la~~L   17 (134)
                      |+|++|+++|.=+|
T Consensus        11 ~~flfl~v~l~PiL   24 (47)
T TIGR02972        11 KALGFIIVVLFPIL   24 (47)
T ss_pred             HHHHHHHHHHHHHH
Confidence            56666665544433


No 87 
>PRK12592 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=35.44  E-value=93  Score=23.18  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=9.9

Q ss_pred             HHHHHHHhhhHHHHHHHH
Q 032762           12 LVSIVLLISSEAAARDLA   29 (134)
Q Consensus        12 ~la~~LlvSSevaArela   29 (134)
                      ++.+|+++.+.+++.-++
T Consensus        80 li~~FlllT~Pvaah~ia   97 (126)
T PRK12592         80 LLVLFALLTSPVTAQRVG   97 (126)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344566677666654333


No 88 
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=35.31  E-value=87  Score=21.18  Aligned_cols=16  Identities=13%  Similarity=0.283  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHhhh
Q 032762            6 FLMLGLLVSIVLLISS   21 (134)
Q Consensus         6 ~llL~l~la~~LlvSS   21 (134)
                      ||+|++++++|.+++.
T Consensus         5 li~lv~~~~i~yf~~~   20 (82)
T PF02699_consen    5 LIPLVIIFVIFYFLMI   20 (82)
T ss_dssp             HHHHHHHHHHHHHHTH
T ss_pred             HHHHHHHHHHHhhhee
Confidence            4445555555555444


No 89 
>COG4313 Protein involved in meta-pathway of phenol degradation [Energy production and conversion]
Probab=35.30  E-value=28  Score=29.70  Aligned_cols=15  Identities=33%  Similarity=0.428  Sum_probs=7.2

Q ss_pred             CchhHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSI   15 (134)
Q Consensus         1 M~sK~~llL~l~la~   15 (134)
                      |++|.+..+++++|+
T Consensus         4 ~~~~lla~~~~~~aa   18 (304)
T COG4313           4 MRSKLLAALVVLLAA   18 (304)
T ss_pred             chhhHHHHHHHHHHH
Confidence            566654444443333


No 90 
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional
Probab=34.96  E-value=37  Score=27.74  Aligned_cols=12  Identities=42%  Similarity=0.598  Sum_probs=6.7

Q ss_pred             Cchh--HHHHHHHH
Q 032762            1 MGSK--VFLMLGLL   12 (134)
Q Consensus         1 M~sK--~~llL~l~   12 (134)
                      |++|  ++++|.++
T Consensus         1 ~~~~~~~~~~~~~~   14 (271)
T PRK11063          1 MAFKFKTFAAVGAL   14 (271)
T ss_pred             CcchHHHHHHHHHH
Confidence            7775  55554443


No 91 
>PRK13893 conjugal transfer protein TrbM; Provisional
Probab=34.67  E-value=24  Score=28.29  Aligned_cols=16  Identities=38%  Similarity=0.422  Sum_probs=6.7

Q ss_pred             CchhHHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVL   17 (134)
Q Consensus         1 M~sK~~llL~l~la~~L   17 (134)
                      |-+| +|.|++++++++
T Consensus         1 m~k~-~~~~~~~~~a~~   16 (193)
T PRK13893          1 MKKK-LLALAALVAALG   16 (193)
T ss_pred             Cchh-HHHHHHHHHHHh
Confidence            5444 444444333333


No 92 
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]
Probab=34.51  E-value=8.3  Score=31.79  Aligned_cols=36  Identities=17%  Similarity=0.249  Sum_probs=26.7

Q ss_pred             HHHHhhhHHHHHHHHHhccccccCccccCcccccCCCccC
Q 032762           15 IVLLISSEAAARDLAETSNDDQKNGEVAGETNGVDDAKYN   54 (134)
Q Consensus        15 ~~LlvSSevaArelaE~~~~~~~k~ev~~~~~gVndak~g   54 (134)
                      +||.|-....|+++.|+++ ..   +++++.+.|+.++|+
T Consensus        58 aFVrf~~k~daedA~damD-G~---~ldgRelrVq~aryg   93 (256)
T KOG4207|consen   58 AFVRFHDKRDAEDALDAMD-GA---VLDGRELRVQMARYG   93 (256)
T ss_pred             eEEEeeecchHHHHHHhhc-ce---eeccceeeehhhhcC
Confidence            3455555566788888877 33   789999999999983


No 93 
>PF11839 DUF3359:  Protein of unknown function (DUF3359);  InterPro: IPR021793  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 80 amino acids in length. 
Probab=34.20  E-value=38  Score=24.29  Aligned_cols=15  Identities=33%  Similarity=0.521  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLL   18 (134)
Q Consensus         4 K~~llL~l~la~~Ll   18 (134)
                      |+||+.+|+++++|+
T Consensus         2 ~k~l~sal~~~~~L~   16 (96)
T PF11839_consen    2 KKLLLSALALAALLL   16 (96)
T ss_pred             chHHHHHHHHHHHHH
Confidence            667776676665554


No 94 
>COG4238 Murein lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=34.18  E-value=36  Score=23.54  Aligned_cols=18  Identities=17%  Similarity=0.300  Sum_probs=13.5

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLL   18 (134)
Q Consensus         1 M~sK~~llL~l~la~~Ll   18 (134)
                      |.+++|+|.+++|..+||
T Consensus         1 m~~~~m~l~Avvlg~lll   18 (78)
T COG4238           1 MKTTKMTLGAVVLGSLLL   18 (78)
T ss_pred             CCcchhhHHHHHHHHHHH
Confidence            677878887777777665


No 95 
>PRK10641 btuB vitamin B12/cobalamin outer membrane transporter; Provisional
Probab=33.95  E-value=10  Score=33.34  Aligned_cols=16  Identities=31%  Similarity=0.262  Sum_probs=9.6

Q ss_pred             CchhHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIV   16 (134)
Q Consensus         1 M~sK~~llL~l~la~~   16 (134)
                      |-.|++|+++|+|+++
T Consensus         1 ~~~~~~~~~~~~~~~~   16 (614)
T PRK10641          1 MIKKASLLTALSVTAF   16 (614)
T ss_pred             CcchHHHHHHHHhccc
Confidence            7778766665544443


No 96 
>PF11162 DUF2946:  Protein of unknown function (DUF2946);  InterPro: IPR021333  This family of proteins has no known function. 
Probab=33.93  E-value=56  Score=21.46  Aligned_cols=12  Identities=17%  Similarity=0.506  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHH
Q 032762            5 VFLMLGLLVSIV   16 (134)
Q Consensus         5 ~~llL~l~la~~   16 (134)
                      ++.+|+++|.+|
T Consensus         3 ~l~l~a~ll~~l   14 (122)
T PF11162_consen    3 WLALLAVLLQVL   14 (122)
T ss_pred             HHHHHHHHHHHH
Confidence            344555544443


No 97 
>TIGR02973 nitrate_rd_NapE periplasmic nitrate reductase, NapE protein. NapE, homologous to TorE (TIGR02972), is a membrane protein of unknown function that is part of the periplasmic nitrate reductase system; it may be part of the enzyme complex. The periplasmic nitrate reductase allows for nitrate respiration in anaerobic conditions.
Probab=33.74  E-value=53  Score=20.20  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=9.3

Q ss_pred             hHHHHHHHHHHHHHHh
Q 032762            4 KVFLMLGLLVSIVLLI   19 (134)
Q Consensus         4 K~~llL~l~la~~Llv   19 (134)
                      |+|++|+++|.=+|.+
T Consensus         6 ~~flfl~~~l~PiLsV   21 (42)
T TIGR02973         6 NTFLFLAAVIWPVLSV   21 (42)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            6777776655444433


No 98 
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=33.73  E-value=20  Score=26.95  Aligned_cols=18  Identities=11%  Similarity=0.312  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHhhhHH
Q 032762            6 FLMLGLLVSIVLLISSEA   23 (134)
Q Consensus         6 ~llL~l~la~~LlvSSev   23 (134)
                      ||++++.||+|.+|.++.
T Consensus        10 lLi~vIglAL~aFIv~d~   27 (145)
T PF13623_consen   10 LLIIVIGLALFAFIVGDF   27 (145)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            444555556655555543


No 99 
>PF05984 Cytomega_UL20A:  Cytomegalovirus UL20A protein;  InterPro: IPR009245 This family consists of several Cytomegalovirus UL20A proteins. UL20A is thought to be a glycoprotein [].
Probab=33.73  E-value=31  Score=24.59  Aligned_cols=19  Identities=21%  Similarity=0.450  Sum_probs=9.0

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |+. ++++|.| ||+.|.|+-
T Consensus         1 MaR-RlwiLsl-LAVtLtVAL   19 (100)
T PF05984_consen    1 MAR-RLWILSL-LAVTLTVAL   19 (100)
T ss_pred             Cch-hhHHHHH-HHHHHHHHh
Confidence            654 4444444 344455543


No 100
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=33.54  E-value=47  Score=23.35  Aligned_cols=20  Identities=30%  Similarity=0.444  Sum_probs=8.9

Q ss_pred             CchhHHHH-HHHHHHHHHHhh
Q 032762            1 MGSKVFLM-LGLLVSIVLLIS   20 (134)
Q Consensus         1 M~sK~~ll-L~l~la~~LlvS   20 (134)
                      |++=+-|+ +.|+||+.|+++
T Consensus         1 m~gvvNL~Dv~LVfav~llva   21 (92)
T PF09919_consen    1 MSGVVNLFDVMLVFAVGLLVA   21 (92)
T ss_pred             CccHHHHHHHHHHHHHHHHHH
Confidence            44433333 445555544443


No 101
>PRK03577 acid shock protein precursor; Provisional
Probab=33.48  E-value=37  Score=24.59  Aligned_cols=16  Identities=38%  Similarity=0.495  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHhhhHH
Q 032762            8 MLGLLVSIVLLISSEA   23 (134)
Q Consensus         8 lL~l~la~~LlvSSev   23 (134)
                      ||+|+++.+|-|||-+
T Consensus         4 VLAlvVAa~~glSs~A   19 (102)
T PRK03577          4 VLALVVAAAMGLSSAA   19 (102)
T ss_pred             HHHHHHHHHHHhhHHH
Confidence            3444445555555543


No 102
>COG1930 CbiN ABC-type cobalt transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=32.97  E-value=49  Score=23.78  Aligned_cols=9  Identities=22%  Similarity=0.848  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 032762           10 GLLVSIVLL   18 (134)
Q Consensus        10 ~l~la~~Ll   18 (134)
                      ++++++.|+
T Consensus        13 ~~i~~l~li   21 (97)
T COG1930          13 GIILALPLI   21 (97)
T ss_pred             HHHHHHHHH
Confidence            334444333


No 103
>PRK06193 hypothetical protein; Provisional
Probab=32.79  E-value=19  Score=28.76  Aligned_cols=9  Identities=22%  Similarity=0.541  Sum_probs=5.9

Q ss_pred             CchhHHHHH
Q 032762            1 MGSKVFLML    9 (134)
Q Consensus         1 M~sK~~llL    9 (134)
                      |+.+++.++
T Consensus         1 ~~~~~~~~~    9 (206)
T PRK06193          1 MARRAMALL    9 (206)
T ss_pred             CcchHHHHH
Confidence            777776554


No 104
>PF09716 ETRAMP:  Malarial early transcribed membrane protein (ETRAMP);  InterPro: IPR006389 These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii []. A homologue from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane []. Members have an initial hydrophobic, Phe/Tyr-rich stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region, and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes.
Probab=32.54  E-value=38  Score=23.24  Aligned_cols=17  Identities=47%  Similarity=0.745  Sum_probs=12.2

Q ss_pred             hhHHHHHHHHHHHHHHh
Q 032762            3 SKVFLMLGLLVSIVLLI   19 (134)
Q Consensus         3 sK~~llL~l~la~~Llv   19 (134)
                      +|.|++++++|++-|+.
T Consensus         4 ~kv~~ff~~Ll~i~~l~   20 (84)
T PF09716_consen    4 SKVFYFFAFLLAINLLT   20 (84)
T ss_pred             HHHHHHHHHHHHHHhCc
Confidence            67888888887775553


No 105
>MTH00261 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=32.39  E-value=46  Score=22.02  Aligned_cols=15  Identities=40%  Similarity=0.764  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHHHhh
Q 032762            6 FLMLGLLVSIVLLIS   20 (134)
Q Consensus         6 ~llL~l~la~~LlvS   20 (134)
                      |+||.|++.+++++|
T Consensus        14 fvllllf~iliilis   28 (68)
T MTH00261         14 FVLLLLFFILIILIS   28 (68)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444444444444444


No 106
>PF14208 DUF4320:  Domain of unknown function (DUF4320)
Probab=32.35  E-value=71  Score=23.30  Aligned_cols=21  Identities=14%  Similarity=0.358  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHhhhHHHHHH
Q 032762            7 LMLGLLVSIVLLISSEAAARD   27 (134)
Q Consensus         7 llL~l~la~~LlvSSevaAre   27 (134)
                      +||+|.+.+|..++.-..+.+
T Consensus         7 ~~ial~v~v~~~~i~~~ql~~   27 (116)
T PF14208_consen    7 FLIALIVSVFPVFIQKQQLNT   27 (116)
T ss_pred             HHHHHHHHHHhhhhhHHHHHH
Confidence            344444444444443333333


No 107
>COG4744 Uncharacterized conserved protein [Function unknown]
Probab=32.29  E-value=46  Score=24.75  Aligned_cols=7  Identities=14%  Similarity=0.444  Sum_probs=2.6

Q ss_pred             HHHHHHH
Q 032762            9 LGLLVSI   15 (134)
Q Consensus         9 L~l~la~   15 (134)
                      ++|+|+.
T Consensus        31 aamVfsv   37 (121)
T COG4744          31 AAMVFSV   37 (121)
T ss_pred             HHHHHHH
Confidence            3333333


No 108
>COG3116 FtsL Cell division protein [Cell division and chromosome partitioning]
Probab=32.23  E-value=77  Score=23.13  Aligned_cols=22  Identities=14%  Similarity=0.291  Sum_probs=10.9

Q ss_pred             HHHHHHHHHhhhHHHHHHHHHh
Q 032762           10 GLLVSIVLLISSEAAARDLAET   31 (134)
Q Consensus        10 ~l~la~~LlvSSevaArelaE~   31 (134)
                      ++++.++.++-+....|.++.+
T Consensus        30 ~ivlsAi~vv~~tH~tRqL~~e   51 (105)
T COG3116          30 AIVLSAIGVVYTTHHTRQLIAE   51 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4444444444444556665544


No 109
>COG2834 LolA Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane]
Probab=32.12  E-value=52  Score=25.70  Aligned_cols=7  Identities=57%  Similarity=0.605  Sum_probs=2.9

Q ss_pred             HHHHHHH
Q 032762           24 AARDLAE   30 (134)
Q Consensus        24 aArelaE   30 (134)
                      +|+++.|
T Consensus        28 ~~~~l~~   34 (211)
T COG2834          28 AASQLKE   34 (211)
T ss_pred             HHHHHHH
Confidence            3344444


No 110
>CHL00038 psbL photosystem II protein L
Probab=32.09  E-value=53  Score=19.75  Aligned_cols=10  Identities=20%  Similarity=0.491  Sum_probs=4.7

Q ss_pred             HHHHHHHhhh
Q 032762           12 LVSIVLLISS   21 (134)
Q Consensus        12 ~la~~LlvSS   21 (134)
                      ++++.+++||
T Consensus        25 ifvl~vlfss   34 (38)
T CHL00038         25 IFVLAVLFSN   34 (38)
T ss_pred             HHHHHHHHHH
Confidence            3334455554


No 111
>TIGR02830 spore_III_AG stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG.
Probab=32.08  E-value=40  Score=26.68  Aligned_cols=14  Identities=43%  Similarity=0.745  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHHhh
Q 032762            7 LMLGLLVSIVLLIS   20 (134)
Q Consensus         7 llL~l~la~~LlvS   20 (134)
                      |+|++++.++|+|.
T Consensus         6 l~il~l~GvlLli~   19 (186)
T TIGR02830         6 LLVLLLIGLLLLIV   19 (186)
T ss_pred             HHHHHHHHHHHHHh
Confidence            33333334444443


No 112
>COG3745 CpaB Flp pilus assembly protein CpaB [Intracellular trafficking and secretion]
Probab=32.01  E-value=42  Score=28.31  Aligned_cols=18  Identities=22%  Similarity=0.263  Sum_probs=11.7

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVLL   18 (134)
Q Consensus         1 M~sK~~llL~l~la~~Ll   18 (134)
                      |-+|.+++|++++++|.+
T Consensus         1 M~~~rliil~~~~~~ag~   18 (276)
T COG3745           1 MRPKRLIILIVALAAAGL   18 (276)
T ss_pred             CCchhHHHHHHHHHHHHH
Confidence            888987666555555443


No 113
>PRK13838 conjugal transfer pilin processing protease TraF; Provisional
Probab=31.94  E-value=54  Score=25.38  Aligned_cols=12  Identities=25%  Similarity=0.238  Sum_probs=6.6

Q ss_pred             CchhHHHHHHHH
Q 032762            1 MGSKVFLMLGLL   12 (134)
Q Consensus         1 M~sK~~llL~l~   12 (134)
                      |-.|+++++.++
T Consensus         1 ~~~~~~~~~~~~   12 (176)
T PRK13838          1 MRRRRALLLLAV   12 (176)
T ss_pred             CCcchHHHHHHH
Confidence            556666554443


No 114
>PRK15137 DNA-specific endonuclease I; Provisional
Probab=31.91  E-value=28  Score=28.68  Aligned_cols=11  Identities=18%  Similarity=0.048  Sum_probs=5.3

Q ss_pred             CchhHHHHHHH
Q 032762            1 MGSKVFLMLGL   11 (134)
Q Consensus         1 M~sK~~llL~l   11 (134)
                      |-.|.||+|+|
T Consensus         1 ~~~~~~~~~~~   11 (235)
T PRK15137          1 MYRNLSIAAVL   11 (235)
T ss_pred             CchhHHHHHHH
Confidence            64555544443


No 115
>PRK11067 outer membrane protein assembly factor YaeT; Provisional
Probab=31.16  E-value=38  Score=31.23  Aligned_cols=12  Identities=42%  Similarity=0.573  Sum_probs=8.6

Q ss_pred             CchhHHHHHHHH
Q 032762            1 MGSKVFLMLGLL   12 (134)
Q Consensus         1 M~sK~~llL~l~   12 (134)
                      ||.|++|+++|+
T Consensus         1 ~~~~~~~~~~~~   12 (803)
T PRK11067          1 MAMKKLLIASLL   12 (803)
T ss_pred             CcHHHHHHHHHH
Confidence            889987665554


No 116
>PRK13680 hypothetical protein; Provisional
Probab=30.35  E-value=41  Score=24.97  Aligned_cols=15  Identities=27%  Similarity=0.149  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHHh
Q 032762            5 VFLMLGLLVSIVLLI   19 (134)
Q Consensus         5 ~~llL~l~la~~Llv   19 (134)
                      .||+++|++++.+++
T Consensus         5 ~l~~~~~l~~~~~~~   19 (117)
T PRK13680          5 ALLGLLLLSACGSVF   19 (117)
T ss_pred             hhHHHHHHHHHHhHh
Confidence            344444444444444


No 117
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=30.26  E-value=79  Score=23.01  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHHHHhhh
Q 032762            6 FLMLGLLVSIVLLISS   21 (134)
Q Consensus         6 ~llL~l~la~~LlvSS   21 (134)
                      ||+|+++|++|.++..
T Consensus         7 ll~lv~i~~i~yF~~i   22 (109)
T PRK05886          7 FLPFLLIMGGFMYFAS   22 (109)
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            4444555555443333


No 118
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=29.86  E-value=29  Score=28.30  Aligned_cols=21  Identities=14%  Similarity=0.343  Sum_probs=9.1

Q ss_pred             hHHHHHHHHH--HHHHHhhhHHH
Q 032762            4 KVFLMLGLLV--SIVLLISSEAA   24 (134)
Q Consensus         4 K~~llL~l~l--a~~LlvSSeva   24 (134)
                      |.+|+|++|+  ++|+++++.++
T Consensus         2 k~~~~~~~~~~~~~f~~~~~~~~   24 (217)
T TIGR03656         2 KKILVFAFFTTILAFIILSAGFS   24 (217)
T ss_pred             cchhhHHHHHHHHHHhccccccc
Confidence            4555543333  33444444443


No 119
>PRK11566 hdeB acid-resistance protein; Provisional
Probab=28.63  E-value=47  Score=24.12  Aligned_cols=17  Identities=18%  Similarity=0.503  Sum_probs=7.5

Q ss_pred             hHHHHHHHHHHHHHHhh
Q 032762            4 KVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         4 K~~llL~l~la~~LlvS   20 (134)
                      |.+++++++.++.+..+
T Consensus         2 ~~~~~~~~~~~~~~~~a   18 (102)
T PRK11566          2 KAFIFMAAVTALSLVNA   18 (102)
T ss_pred             chhHHHHHHHHHHHHhh
Confidence            44555444444433333


No 120
>PF12555 TPPK_C:  Thiamine pyrophosphokinase C terminal;  InterPro: IPR022215  This domain family is found in bacteria, and is approximately 50 amino acids in length. The proteins in this family catalyses the pyrophosphorylation of thiamine in yeast and synthesizes thiamine pyrophosphate (TPP), a thiamine coenzyme. 
Probab=28.58  E-value=80  Score=19.78  Aligned_cols=8  Identities=38%  Similarity=0.625  Sum_probs=3.3

Q ss_pred             HHHHHHHH
Q 032762            9 LGLLVSIV   16 (134)
Q Consensus         9 L~l~la~~   16 (134)
                      |+.+++++
T Consensus        21 laaLvav~   28 (53)
T PF12555_consen   21 LAALVAVA   28 (53)
T ss_pred             HHHHHHHH
Confidence            44444443


No 121
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=28.43  E-value=16  Score=22.86  Aligned_cols=17  Identities=18%  Similarity=0.530  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 032762            5 VFLMLGLLVSIVLLISS   21 (134)
Q Consensus         5 ~~llL~l~la~~LlvSS   21 (134)
                      ++++++++++++||.+.
T Consensus         3 Ki~~~~i~~~~~~L~aC   19 (46)
T PF02402_consen    3 KIIFIGIFLLTMLLAAC   19 (46)
T ss_pred             EEEEeHHHHHHHHHHHh
Confidence            33343444334444433


No 122
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=28.30  E-value=3.1e+02  Score=22.76  Aligned_cols=6  Identities=0%  Similarity=0.041  Sum_probs=2.4

Q ss_pred             HHHhcc
Q 032762           28 LAETSN   33 (134)
Q Consensus        28 laE~~~   33 (134)
                      +.++++
T Consensus       156 VLsAMq  161 (238)
T PF02084_consen  156 VLSAMQ  161 (238)
T ss_pred             HHHHHh
Confidence            333444


No 123
>TIGR03778 VPDSG_CTERM VPDSG-CTERM exosortase interaction domain. Through in silico analysis, we previously described the PEP-CTERM/exosortase system (PubMed:16930487). This model describes a PEP-CTERM-like variant C-terminal protein sorting signal, as found at the C-terminus of twenty otherwise unrelated proteins in Verrucomicrobiae bacterium DG1235. The variant motif, VPDSG, seems an intermediate between the VPEP motif (TIGR02595) of typical exosortase systems and the classical LPXTG of sortase in Gram-positive bacteria.
Probab=28.30  E-value=83  Score=17.45  Aligned_cols=13  Identities=31%  Similarity=0.381  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHH
Q 032762            5 VFLMLGLLVSIVL   17 (134)
Q Consensus         5 ~~llL~l~la~~L   17 (134)
                      +++||++.|++++
T Consensus         7 T~~Ll~~~l~~l~   19 (26)
T TIGR03778         7 TLALLGLGLLGLL   19 (26)
T ss_pred             HHHHHHHHHHHHH
Confidence            4555555444443


No 124
>PF07437 YfaZ:  YfaZ precursor;  InterPro: IPR009998 This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.
Probab=28.18  E-value=29  Score=27.05  Aligned_cols=22  Identities=36%  Similarity=0.460  Sum_probs=10.1

Q ss_pred             hHHHHHHHHHHHHHHhhhHHHHHH
Q 032762            4 KVFLMLGLLVSIVLLISSEAAARD   27 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSevaAre   27 (134)
                      |+++|++++  +++++|..+.|.+
T Consensus         2 ~k~~~a~~~--~l~~~s~~a~A~~   23 (180)
T PF07437_consen    2 KKFLLASAA--ALLLVSASANAIS   23 (180)
T ss_pred             chHHHHHHH--HHHHHhhhhheee
Confidence            566654432  3344444444443


No 125
>PF06692 MNSV_P7B:  Melon necrotic spot virus P7B protein;  InterPro: IPR009575 This family consists of several Melon necrotic spot virus (MNSV) P7B proteins. The function of this family is unknown.
Probab=28.08  E-value=56  Score=21.44  Aligned_cols=10  Identities=40%  Similarity=0.550  Sum_probs=4.5

Q ss_pred             HHHHHHHHHH
Q 032762            7 LMLGLLVSIV   16 (134)
Q Consensus         7 llL~l~la~~   16 (134)
                      +||+|+++++
T Consensus        16 ~lLiliis~~   25 (61)
T PF06692_consen   16 PLLILIISFV   25 (61)
T ss_pred             HHHHHHHHHH
Confidence            3444544443


No 126
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional
Probab=28.06  E-value=49  Score=26.77  Aligned_cols=17  Identities=12%  Similarity=0.153  Sum_probs=7.0

Q ss_pred             hHHHHHHHHHHHHHHhh
Q 032762            4 KVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         4 K~~llL~l~la~~LlvS   20 (134)
                      |+++++.++++++++++
T Consensus         2 ~~~~~~~~~~~~~~~~~   18 (237)
T PRK11009          2 KKITLALSAVCLLFALN   18 (237)
T ss_pred             chhHHHHHHHHHHHHcc
Confidence            34444433444444333


No 127
>PLN02682 pectinesterase family protein
Probab=28.03  E-value=20  Score=31.22  Aligned_cols=17  Identities=35%  Similarity=0.483  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHHhhhHH
Q 032762            7 LMLGLLVSIVLLISSEA   23 (134)
Q Consensus         7 llL~l~la~~LlvSSev   23 (134)
                      +|+.|||.+|||-|+..
T Consensus         7 ~~~~~~~~~~~~~~~~~   23 (369)
T PLN02682          7 FLACLLLLVFLLPSSQT   23 (369)
T ss_pred             hHHHHHHHHhhccCCcc
Confidence            33444444555544433


No 128
>TIGR02659 TTQ_MADH_Lt methylamine dehydrogenase light chain. This family consists of the light chain of methylamine dehydrogenase light chain, a periplasmic enzyme. This subunit contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from Trp-114 and Trp-165 of the precursor, numbered according to the sequence from Paracoccus denitrificans. The enzyme forms a complex with the type I blue copper protein amicyanin and cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome.
Probab=28.01  E-value=40  Score=26.88  Aligned_cols=30  Identities=27%  Similarity=0.399  Sum_probs=22.8

Q ss_pred             CCCCCCCccCCCccCCCCcccccccccccCCCC
Q 032762          102 YGCCGRGYYGRGCRCCSYAGEAVNAQTEAEPQN  134 (134)
Q Consensus       102 ~gcc~~~~~g~c~rcc~~~~e~~~~~~~~~~~~  134 (134)
                      +=||++..   |.||=+..-|--.|+++++.+|
T Consensus       130 nDCCGk~~---CgrC~C~~~ege~P~Yrp~~~N  159 (186)
T TIGR02659       130 RDCCGYNV---SGRCPCLNTEGELPVYRPEFAN  159 (186)
T ss_pred             ccccCCCc---cCceeccCCcCCCcccccCcCC
Confidence            56998877   5576666667777888888777


No 129
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=27.90  E-value=71  Score=21.43  Aligned_cols=13  Identities=31%  Similarity=0.470  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHH
Q 032762            5 VFLMLGLLVSIVL   17 (134)
Q Consensus         5 ~~llL~l~la~~L   17 (134)
                      +|++|+++|+.+|
T Consensus         9 af~vLvi~l~~~l   21 (90)
T PF06103_consen    9 AFAVLVIFLIKVL   21 (90)
T ss_pred             HHHHHHHHHHHHH
Confidence            3555555544433


No 130
>PF13893 RRM_5:  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain); PDB: 2PE8_A 2PEH_A 2D9O_A 1A9N_D 2DIT_A 3S6E_A 2LQ5_A 1SJQ_A 2AD9_A 1X4D_A ....
Probab=27.87  E-value=8.1  Score=23.31  Aligned_cols=31  Identities=19%  Similarity=0.197  Sum_probs=19.9

Q ss_pred             HHHHhhhHHHHHHHHHhccccccCccccCcccccC
Q 032762           15 IVLLISSEAAARDLAETSNDDQKNGEVAGETNGVD   49 (134)
Q Consensus        15 ~~LlvSSevaArelaE~~~~~~~k~ev~~~~~gVn   49 (134)
                      +||.+++..+|+.+.++++ ..   ...++++.|+
T Consensus        24 a~V~f~~~~~A~~a~~~l~-~~---~~~g~~l~V~   54 (56)
T PF13893_consen   24 AFVEFASVEDAQKAIEQLN-GR---QFNGRPLKVS   54 (56)
T ss_dssp             EEEEESSHHHHHHHHHHHT-TS---EETTEEEEEE
T ss_pred             EEEEECCHHHHHHHHHHhC-CC---EECCcEEEEE
Confidence            3467788888899888877 22   3444444443


No 131
>COG4727 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.75  E-value=68  Score=26.88  Aligned_cols=15  Identities=20%  Similarity=0.490  Sum_probs=8.3

Q ss_pred             CchhHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSI   15 (134)
Q Consensus         1 M~sK~~llL~l~la~   15 (134)
                      |..|.+++|+++|++
T Consensus         1 m~~~~~~v~afal~l   15 (287)
T COG4727           1 MSAARLLVLAFALAL   15 (287)
T ss_pred             CchHHHHHHHHHHHH
Confidence            655666655554444


No 132
>COG5353 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.62  E-value=67  Score=25.03  Aligned_cols=13  Identities=31%  Similarity=0.564  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHhhh
Q 032762            9 LGLLVSIVLLISS   21 (134)
Q Consensus         9 L~l~la~~LlvSS   21 (134)
                      |++++++++.+.+
T Consensus        17 lai~~s~~~~~~~   29 (161)
T COG5353          17 LAIILSIALFFWK   29 (161)
T ss_pred             HHHHHHHHHHHhH
Confidence            4444555554443


No 133
>PRK06287 cobalt transport protein CbiN; Validated
Probab=27.43  E-value=74  Score=22.85  Aligned_cols=11  Identities=55%  Similarity=0.899  Sum_probs=5.2

Q ss_pred             CchhHHHHHHH
Q 032762            1 MGSKVFLMLGL   11 (134)
Q Consensus         1 M~sK~~llL~l   11 (134)
                      |-.|+||+..+
T Consensus         2 ~~~~~~~~~~~   12 (107)
T PRK06287          2 MDNKKFLIAGL   12 (107)
T ss_pred             CcchhhHHHHH
Confidence            44455555333


No 134
>PRK05996 motB flagellar motor protein MotB; Validated
Probab=27.30  E-value=98  Score=27.61  Aligned_cols=8  Identities=13%  Similarity=0.621  Sum_probs=3.4

Q ss_pred             HHHHHHHH
Q 032762            8 MLGLLVSI   15 (134)
Q Consensus         8 lL~l~la~   15 (134)
                      ||+|||++
T Consensus        43 lm~fFl~l   50 (423)
T PRK05996         43 MMAFFLVM   50 (423)
T ss_pred             HHHHHHHH
Confidence            34444433


No 135
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=26.86  E-value=57  Score=23.80  Aligned_cols=9  Identities=22%  Similarity=0.242  Sum_probs=3.7

Q ss_pred             HHHHHHhhh
Q 032762           13 VSIVLLISS   21 (134)
Q Consensus        13 la~~LlvSS   21 (134)
                      +++|+++++
T Consensus        10 ~~~~~~~~~   18 (115)
T PRK09838         10 FSLFSVIGF   18 (115)
T ss_pred             HHHHHHHhh
Confidence            334444443


No 136
>PF07271 Cytadhesin_P30:  Cytadhesin P30/P32;  InterPro: IPR009896 This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localised on the tip organelle. It is thought that it is important in cytadherence and virulence [].; GO: 0007157 heterophilic cell-cell adhesion, 0009405 pathogenesis, 0016021 integral to membrane
Probab=26.67  E-value=78  Score=26.79  Aligned_cols=12  Identities=50%  Similarity=0.592  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHH
Q 032762            6 FLMLGLLVSIVL   17 (134)
Q Consensus         6 ~llL~l~la~~L   17 (134)
                      ||++.||+..||
T Consensus        12 ~~~~~~~~~~~~   23 (279)
T PF07271_consen   12 FLLAWLLFVSVL   23 (279)
T ss_pred             HHHHHHHHHHHH
Confidence            444455444443


No 137
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=26.64  E-value=14  Score=30.79  Aligned_cols=26  Identities=31%  Similarity=0.266  Sum_probs=18.2

Q ss_pred             HHHHHHHhccccccCccccCcccccCCCcc
Q 032762           24 AARDLAETSNDDQKNGEVAGETNGVDDAKY   53 (134)
Q Consensus        24 aArelaE~~~~~~~k~ev~~~~~gVndak~   53 (134)
                      .|..+++.|+ +.   |+-+|+++||.+++
T Consensus        64 DAaaAiDNMn-es---EL~GrtirVN~AkP   89 (298)
T KOG0111|consen   64 DAAAAIDNMN-ES---ELFGRTIRVNLAKP   89 (298)
T ss_pred             hhHHHhhcCc-hh---hhcceeEEEeecCC
Confidence            3445566666 22   67899999998876


No 138
>PF01307 Plant_vir_prot:  Plant viral movement protein;  InterPro: IPR001896 This family of membrane/coat proteins are found in a number of different ssRNA plant virus families that include Potexvirus, Hordeivirus and Carlavirus.
Probab=26.45  E-value=51  Score=23.69  Aligned_cols=18  Identities=39%  Similarity=0.501  Sum_probs=12.1

Q ss_pred             hhHHHHHHHHHHHHHHhh
Q 032762            3 SKVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         3 sK~~llL~l~la~~LlvS   20 (134)
                      +|.+|.+++.++++|++.
T Consensus         8 sk~~l~~aiG~~lal~i~   25 (104)
T PF01307_consen    8 SKSYLAAAIGVSLALIIF   25 (104)
T ss_pred             ccchhHHHHHHHHHHHHH
Confidence            577887777666665553


No 139
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=26.18  E-value=72  Score=28.25  Aligned_cols=20  Identities=30%  Similarity=0.277  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHhhhHHH
Q 032762            5 VFLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         5 ~~llL~l~la~~LlvSSeva   24 (134)
                      +.-+|+|+||+.+|++++.+
T Consensus         3 a~aclalvl~a~~l~~~~~a   22 (434)
T KOG3555|consen    3 ASACLALVLAAWCLIGSAEA   22 (434)
T ss_pred             hhHHHHHHHHHHHHHHHHHH
Confidence            44577888888888877554


No 140
>COG1320 MnhG Multisubunit Na+/H+ antiporter, MnhG subunit [Inorganic ion transport and metabolism]
Probab=26.12  E-value=93  Score=22.74  Aligned_cols=23  Identities=17%  Similarity=0.486  Sum_probs=13.2

Q ss_pred             HHHHHHHHhhhHHHHHHHHHhcc
Q 032762           11 LLVSIVLLISSEAAARDLAETSN   33 (134)
Q Consensus        11 l~la~~LlvSSevaArelaE~~~   33 (134)
                      +++++|+++.+.++|--++.+.-
T Consensus        70 il~~lfi~lt~Pv~ah~iarAay   92 (113)
T COG1320          70 ILLALFILLTAPVGAHAIARAAY   92 (113)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHH
Confidence            34455667777776655554433


No 141
>PF10614 CsgF:  Type VIII secretion system (T8SS), CsgF protein;  InterPro: IPR018893  Fimbriae are cell-surface protein polymers, of e.g. Escherichia coli and Salmonella spp, that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), that differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae (Tafi) are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp. and the controlling operon termed agf; however subsequent isolation of the homologous operon in E. coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix []. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery []. 
Probab=25.88  E-value=24  Score=26.88  Aligned_cols=23  Identities=39%  Similarity=0.462  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHHhhhHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLLISSEAAARDL   28 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSevaArel   28 (134)
                      |..+||++++++  +++..+.|.++
T Consensus         2 k~~~l~a~l~~~--~~~~~a~A~eL   24 (142)
T PF10614_consen    2 KYRGLLALLLLL--LAASSAQAQEL   24 (142)
T ss_pred             cEeHHHHHHHHH--Hcccccchhhe
Confidence            444445544222  22444445544


No 142
>PRK10455 periplasmic protein; Reviewed
Probab=25.61  E-value=68  Score=24.59  Aligned_cols=13  Identities=23%  Similarity=0.419  Sum_probs=7.2

Q ss_pred             HHHHHHHHHhhhH
Q 032762           10 GLLVSIVLLISSE   22 (134)
Q Consensus        10 ~l~la~~LlvSSe   22 (134)
                      +|+||++|.+++.
T Consensus         6 ~~~~as~l~~g~~   18 (161)
T PRK10455          6 ALFVASTLALGAA   18 (161)
T ss_pred             HHHHHHHHHHHHH
Confidence            4455666665554


No 143
>PRK10208 acid-resistance protein; Provisional
Probab=25.57  E-value=56  Score=24.17  Aligned_cols=16  Identities=25%  Similarity=0.416  Sum_probs=6.8

Q ss_pred             hHHHH--HHHHHHHHHHh
Q 032762            4 KVFLM--LGLLVSIVLLI   19 (134)
Q Consensus         4 K~~ll--L~l~la~~Llv   19 (134)
                      |..++  |+++|++.|++
T Consensus         5 ~~~~~~a~a~~~~~~~~~   22 (114)
T PRK10208          5 KTNMKKALAVVLGGLLLL   22 (114)
T ss_pred             HhHHHHHHHHHHHhhhhh
Confidence            44444  44444444444


No 144
>CHL00066 psbH photosystem II protein H
Probab=25.44  E-value=55  Score=22.42  Aligned_cols=10  Identities=30%  Similarity=0.348  Sum_probs=4.8

Q ss_pred             HHHHHHHhhh
Q 032762           12 LVSIVLLISS   21 (134)
Q Consensus        12 ~la~~LlvSS   21 (134)
                      +||+||+|..
T Consensus        49 lf~vfl~iiL   58 (73)
T CHL00066         49 LFAVFLSIIL   58 (73)
T ss_pred             HHHHHHHHHH
Confidence            3445555543


No 145
>PRK10095 ribonuclease I; Provisional
Probab=25.43  E-value=44  Score=27.84  Aligned_cols=6  Identities=50%  Similarity=0.761  Sum_probs=2.7

Q ss_pred             cCCCCc
Q 032762          115 RCCSYA  120 (134)
Q Consensus       115 rcc~~~  120 (134)
                      +-|.++
T Consensus       118 ~~C~~~  123 (268)
T PRK10095        118 RKCSAP  123 (268)
T ss_pred             ccccCC
Confidence            345543


No 146
>PRK09973 putative outer membrane lipoprotein; Provisional
Probab=25.42  E-value=76  Score=22.24  Aligned_cols=15  Identities=20%  Similarity=0.456  Sum_probs=8.0

Q ss_pred             hHHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLL   18 (134)
Q Consensus         4 K~~llL~l~la~~Ll   18 (134)
                      |+|++.+++|+++||
T Consensus         3 ~klll~aviLs~~LL   17 (85)
T PRK09973          3 TIFTVGAVVLATCLL   17 (85)
T ss_pred             hhHHHHHHHHHHHHH
Confidence            455555555555444


No 147
>PF03866 HAP:  Hydrophobic abundant protein (HAP)        ;  InterPro: IPR005566  Expression of Hydrophobic Abundant protein is thought to be developmentally regulated and possibly involved in spherule cell wall formation []. 
Probab=25.25  E-value=98  Score=23.86  Aligned_cols=20  Identities=15%  Similarity=0.383  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHhhhHHH
Q 032762            5 VFLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         5 ~~llL~l~la~~LlvSSeva   24 (134)
                      ++++++|.|.+++.+++|+.
T Consensus         3 kyvfvalc~~avvalate~~   22 (164)
T PF03866_consen    3 KYVFVALCLFAVVALATEVE   22 (164)
T ss_pred             hhHHHHHHHHHHHHHhhHHH
Confidence            45556665556666666654


No 148
>PRK11372 lysozyme inhibitor; Provisional
Probab=25.09  E-value=65  Score=23.17  Aligned_cols=11  Identities=36%  Similarity=0.549  Sum_probs=6.7

Q ss_pred             CchhHHHHHHH
Q 032762            1 MGSKVFLMLGL   11 (134)
Q Consensus         1 M~sK~~llL~l   11 (134)
                      |-.|++|+|++
T Consensus         1 ~~mk~ll~~~~   11 (109)
T PRK11372          1 MSMKKLLIICL   11 (109)
T ss_pred             CchHHHHHHHH
Confidence            66687665544


No 149
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=25.08  E-value=75  Score=19.74  Aligned_cols=9  Identities=22%  Similarity=0.519  Sum_probs=4.0

Q ss_pred             HHHHHHHHH
Q 032762            9 LGLLVSIVL   17 (134)
Q Consensus         9 L~l~la~~L   17 (134)
                      +.|+|.+||
T Consensus        11 mIiflslfl   19 (54)
T PF07127_consen   11 MIIFLSLFL   19 (54)
T ss_pred             HHHHHHHHH
Confidence            444444444


No 150
>PHA02054 hypothetical protein
Probab=25.03  E-value=46  Score=23.50  Aligned_cols=20  Identities=35%  Similarity=0.547  Sum_probs=14.8

Q ss_pred             hhHHHHHHHHHHHHHHhhhH
Q 032762            3 SKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         3 sK~~llL~l~la~~LlvSSe   22 (134)
                      .|.|..++|++|.+-+++.+
T Consensus         2 ~k~~~~ial~~a~~h~v~a~   21 (94)
T PHA02054          2 PKIIAAVALLVATVHLVSAN   21 (94)
T ss_pred             chhHHHHHHHHHHhheeecC
Confidence            47788888888887777654


No 151
>COG3470 Tpd Uncharacterized protein probably involved in high-affinity Fe2+ transport [Inorganic ion transport and metabolism]
Probab=24.94  E-value=62  Score=25.54  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=9.4

Q ss_pred             CchhHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIV   16 (134)
Q Consensus         1 M~sK~~llL~l~la~~   16 (134)
                      |-.|++||-+++||++
T Consensus         1 M~~~k~l~~~~~~a~v   16 (179)
T COG3470           1 MKMKKLLLSAAILASV   16 (179)
T ss_pred             CchHHHHHHHHHHHHH
Confidence            5566777665554443


No 152
>COG1991 Uncharacterized conserved protein [Function unknown]
Probab=24.55  E-value=1.1e+02  Score=23.18  Aligned_cols=6  Identities=33%  Similarity=0.329  Sum_probs=2.4

Q ss_pred             hhHHHH
Q 032762            3 SKVFLM    8 (134)
Q Consensus         3 sK~~ll    8 (134)
                      |+.|+|
T Consensus        17 SLEf~L   22 (131)
T COG1991          17 SLEFSL   22 (131)
T ss_pred             eeehHH
Confidence            344443


No 153
>PRK01326 prsA foldase protein PrsA; Reviewed
Probab=24.34  E-value=65  Score=26.75  Aligned_cols=9  Identities=11%  Similarity=0.084  Sum_probs=4.1

Q ss_pred             hHHHHHHHH
Q 032762            4 KVFLMLGLL   12 (134)
Q Consensus         4 K~~llL~l~   12 (134)
                      |++|+++++
T Consensus         3 kk~~~~~~~   11 (310)
T PRK01326          3 KKLIAGAVT   11 (310)
T ss_pred             hhHHHHHHH
Confidence            455444443


No 154
>PRK09125 DNA ligase; Provisional
Probab=24.25  E-value=38  Score=27.95  Aligned_cols=16  Identities=44%  Similarity=0.771  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHhhh
Q 032762            6 FLMLGLLVSIVLLISS   21 (134)
Q Consensus         6 ~llL~l~la~~LlvSS   21 (134)
                      ||||.|+||++|+++-
T Consensus         1 ~~~~~~~~~~~~~~~~   16 (282)
T PRK09125          1 FLLLLLLLALALLLAL   16 (282)
T ss_pred             CchHHHHHHHHHHHHH
Confidence            3555556666665543


No 155
>PLN00055 photosystem II reaction center protein H; Provisional
Probab=23.92  E-value=61  Score=22.20  Aligned_cols=10  Identities=30%  Similarity=0.348  Sum_probs=4.6

Q ss_pred             HHHHHHHhhh
Q 032762           12 LVSIVLLISS   21 (134)
Q Consensus        12 ~la~~LlvSS   21 (134)
                      +||+||+|..
T Consensus        49 lf~vfl~iil   58 (73)
T PLN00055         49 LFAVFLSIIL   58 (73)
T ss_pred             HHHHHHHHHH
Confidence            3444555443


No 156
>PF05479 PsaN:  Photosystem I reaction centre subunit N (PSAN or PSI-N);  InterPro: IPR008796 This family contains several Photosystem I reaction centre subunit N (PSI-N) proteins. The protein has no known function although it is localised in the thylakoid lumen []. PSI-N is a small extrinsic subunit at the lumen side and is very likely involved in the docking of plastocyanin.; GO: 0005516 calmodulin binding, 0015979 photosynthesis, 0009522 photosystem I, 0042651 thylakoid membrane; PDB: 2WSE_N 2WSC_N 2WSF_N 2O01_N.
Probab=23.88  E-value=25  Score=26.75  Aligned_cols=7  Identities=29%  Similarity=0.363  Sum_probs=0.0

Q ss_pred             HHHHHHH
Q 032762            6 FLMLGLL   12 (134)
Q Consensus         6 ~llL~l~   12 (134)
                      +|+|+.+
T Consensus        34 ll~Laa~   40 (138)
T PF05479_consen   34 LLGLAAV   40 (138)
T ss_dssp             -------
T ss_pred             HHHHHHH
Confidence            4444433


No 157
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=23.84  E-value=64  Score=22.88  Aligned_cols=8  Identities=0%  Similarity=0.289  Sum_probs=3.0

Q ss_pred             HHHHHHHH
Q 032762            8 MLGLLVSI   15 (134)
Q Consensus         8 lL~l~la~   15 (134)
                      ||+|++++
T Consensus        10 lIIlvIvL   17 (89)
T PRK03554         10 LIIAVIVV   17 (89)
T ss_pred             HHHHHHHH
Confidence            33333333


No 158
>PF08999 SP_C-Propep:  Surfactant protein C, N terminal propeptide;  InterPro: IPR015091 The N-terminal propeptide of surfactant protein C adopts an alpha-helical structure, with turn and extended regions. Its main function is the stabilisation of metastable surfactant protein C (SP-C), since the latter can irreversibly transform from its native alpha-helical structure to beta-sheet aggregates and form amyloid-like fibrils. The correct intracellular trafficking of proSP-C has also been reported to depend on the propeptide []. ; PDB: 1SPF_A 2YAD_F.
Probab=23.81  E-value=1e+02  Score=21.74  Aligned_cols=15  Identities=27%  Similarity=0.556  Sum_probs=7.9

Q ss_pred             hHHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVLL   18 (134)
Q Consensus         4 K~~llL~l~la~~Ll   18 (134)
                      |+||++.+++.++|+
T Consensus        34 KrlliivvVvVlvVv   48 (93)
T PF08999_consen   34 KRLLIIVVVVVLVVV   48 (93)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             ceEEEEEEeeehhHH
Confidence            777665554434333


No 159
>PF04956 TrbC:  TrbC/VIRB2 family;  InterPro: IPR007039 Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure[]. This family also contains several VirB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species [].
Probab=23.75  E-value=79  Score=21.35  Aligned_cols=12  Identities=42%  Similarity=0.517  Sum_probs=5.5

Q ss_pred             HHHHhhhHHHHH
Q 032762           15 IVLLISSEAAAR   26 (134)
Q Consensus        15 ~~LlvSSevaAr   26 (134)
                      +++++++.+.|+
T Consensus        20 ~~~~~~~~A~A~   31 (99)
T PF04956_consen   20 ALLLLASPAFAQ   31 (99)
T ss_pred             HHHHhCchhhhc
Confidence            344455444443


No 160
>PF11355 DUF3157:  Protein of unknown function (DUF3157);  InterPro: IPR021501  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=23.54  E-value=51  Score=26.56  Aligned_cols=12  Identities=33%  Similarity=0.675  Sum_probs=6.7

Q ss_pred             hHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSI   15 (134)
Q Consensus         4 K~~llL~l~la~   15 (134)
                      |.+++|+|+|++
T Consensus         2 k~~~~lalll~s   13 (199)
T PF11355_consen    2 KTYILLALLLLS   13 (199)
T ss_pred             chHHHHHHHHHh
Confidence            556666665433


No 161
>PLN02713 Probable pectinesterase/pectinesterase inhibitor
Probab=23.48  E-value=71  Score=29.35  Aligned_cols=21  Identities=38%  Similarity=0.569  Sum_probs=12.4

Q ss_pred             CchhHHHHHHHHHHHHHHhhh
Q 032762            1 MGSKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSS   21 (134)
                      |++|..+|-+|.|.++|++|.
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~   21 (566)
T PLN02713          1 MSSKLILLTTLALLLLLFFSS   21 (566)
T ss_pred             CchhHHHHHHHHHHHHHhcch
Confidence            889876665555534444443


No 162
>PF07771 TSGP1:  Tick salivary peptide group 1;  InterPro: IPR011694 This entry contains a group of peptides derived from a salivary gland cDNA library of the tick Ixodes scapularis (Black-legged tick) []. Also present are peptides from a related tick species, Ixodes ricinus (Sheep tick). They are characterised by a putative signal peptide, indicative of secretion, and conserved cysteine residues.
Probab=23.38  E-value=36  Score=25.12  Aligned_cols=8  Identities=50%  Similarity=1.344  Sum_probs=4.4

Q ss_pred             CCCCCCCC
Q 032762           98 GYCRYGCC  105 (134)
Q Consensus        98 ~~c~~gcc  105 (134)
                      +.|..|=|
T Consensus        70 G~C~~G~C   77 (120)
T PF07771_consen   70 GVCQDGLC   77 (120)
T ss_pred             eEecCCEE
Confidence            45665554


No 163
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the B subunit.
Probab=23.11  E-value=57  Score=24.63  Aligned_cols=16  Identities=25%  Similarity=0.378  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHhhhHH
Q 032762            8 MLGLLVSIVLLISSEA   23 (134)
Q Consensus         8 lL~l~la~~LlvSSev   23 (134)
                      +|+|+|.++|.++|.+
T Consensus        11 ~~g~~~~~~l~~~~~~   26 (165)
T TIGR01944        11 ALGLALGAILGYAARR   26 (165)
T ss_pred             HHHHHHHHHHHHheee
Confidence            3677777777777754


No 164
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=23.10  E-value=28  Score=25.91  Aligned_cols=13  Identities=38%  Similarity=0.692  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhh
Q 032762            8 MLGLLVSIVLLIS   20 (134)
Q Consensus         8 lL~l~la~~LlvS   20 (134)
                      +|+|+|+++|+|.
T Consensus        31 iL~VILgiLLliG   43 (118)
T PF14991_consen   31 ILIVILGILLLIG   43 (118)
T ss_dssp             -------------
T ss_pred             eHHHHHHHHHHHh
Confidence            4556666666664


No 165
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=22.95  E-value=70  Score=29.10  Aligned_cols=22  Identities=18%  Similarity=0.264  Sum_probs=16.1

Q ss_pred             CchhHHHHHHHHHHHHHHhhhH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSe   22 (134)
                      |-++.||||..+++++|++|+-
T Consensus         1 ~~~~~~~~~~~~~~~~~~~s~c   22 (521)
T PRK14018          1 MKHRTFFSLCAKFGCLLALGAC   22 (521)
T ss_pred             CcchHHHHHHHHHHHHHhhccc
Confidence            7777888877777777777654


No 166
>PF10956 DUF2756:  Protein of unknown function (DUF2756);  InterPro: IPR020158 This entry contains proteins with no known function.
Probab=22.86  E-value=67  Score=23.36  Aligned_cols=9  Identities=44%  Similarity=0.630  Sum_probs=5.3

Q ss_pred             hHHHHHHHH
Q 032762            4 KVFLMLGLL   12 (134)
Q Consensus         4 K~~llL~l~   12 (134)
                      |++|+|+++
T Consensus         2 K~ll~laal   10 (104)
T PF10956_consen    2 KRLLILAAL   10 (104)
T ss_pred             hHHHHHHHH
Confidence            666665544


No 167
>PRK02463 OxaA-like protein precursor; Provisional
Probab=22.46  E-value=78  Score=26.78  Aligned_cols=19  Identities=32%  Similarity=0.489  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHHHHHhhhH
Q 032762            4 KVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         4 K~~llL~l~la~~LlvSSe   22 (134)
                      |++++++++++++|++|.-
T Consensus         6 k~~~~~~~~~~~~~~lsgc   24 (307)
T PRK02463          6 KRILFSGLALSMLLTLTGC   24 (307)
T ss_pred             HHHHHHHHHHHHHHHHhcc
Confidence            4566666666666666554


No 168
>PRK10259 hypothetical protein; Provisional
Probab=22.42  E-value=94  Score=21.65  Aligned_cols=12  Identities=8%  Similarity=0.144  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q 032762            5 VFLMLGLLVSIV   16 (134)
Q Consensus         5 ~~llL~l~la~~   16 (134)
                      ++++.+|+|+++
T Consensus         5 k~~~aa~~ls~~   16 (86)
T PRK10259          5 NTVVAAMALSTL   16 (86)
T ss_pred             HHHHHHHHHHHh
Confidence            344444444443


No 169
>PF11777 DUF3316:  Protein of unknown function (DUF3316);  InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.41  E-value=89  Score=22.23  Aligned_cols=7  Identities=29%  Similarity=0.600  Sum_probs=3.3

Q ss_pred             hHHHHHH
Q 032762            4 KVFLMLG   10 (134)
Q Consensus         4 K~~llL~   10 (134)
                      |+++||+
T Consensus         2 Kk~~ll~    8 (114)
T PF11777_consen    2 KKIILLA    8 (114)
T ss_pred             chHHHHH
Confidence            5544443


No 170
>PF07312 DUF1459:  Protein of unknown function (DUF1459);  InterPro: IPR009924 This family consists of several hypothetical Caenorhabditis elegans proteins of around 85 residues in length. The function of this family is unknown.
Probab=22.36  E-value=81  Score=22.08  Aligned_cols=11  Identities=36%  Similarity=0.350  Sum_probs=6.9

Q ss_pred             CchhHHHHHHH
Q 032762            1 MGSKVFLMLGL   11 (134)
Q Consensus         1 M~sK~~llL~l   11 (134)
                      |=+|-|++|+|
T Consensus         1 MF~Kc~~~l~l   11 (84)
T PF07312_consen    1 MFQKCIIVLLL   11 (84)
T ss_pred             ChHHHHHHHHH
Confidence            66787766643


No 171
>PF06990 Gal-3-0_sulfotr:  Galactose-3-O-sulfotransferase ;  InterPro: IPR009729 This family consists of several mammalian galactose-3-O-sulphotransferase proteins. Gal-3-O-sulphotransferase is thought to play a critical role in 3'-sulphation of N-acetyllactosamine in both O- and N-glycans [].; GO: 0001733 galactosylceramide sulfotransferase activity, 0009058 biosynthetic process, 0005794 Golgi apparatus, 0016021 integral to membrane
Probab=22.36  E-value=44  Score=29.17  Aligned_cols=19  Identities=32%  Similarity=0.296  Sum_probs=11.4

Q ss_pred             hhHHHHHHHHHHHHHHhhh
Q 032762            3 SKVFLMLGLLVSIVLLISS   21 (134)
Q Consensus         3 sK~~llL~l~la~~LlvSS   21 (134)
                      .|.+||++|+|++|+++..
T Consensus        17 ~~~l~l~~l~~~~~~l~~~   35 (402)
T PF06990_consen   17 RKGLVLGVLLLSSFLLLVY   35 (402)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4556666666666665443


No 172
>PRK11443 lipoprotein; Provisional
Probab=22.22  E-value=73  Score=23.52  Aligned_cols=8  Identities=38%  Similarity=0.330  Sum_probs=3.8

Q ss_pred             hHHHHHHH
Q 032762            4 KVFLMLGL   11 (134)
Q Consensus         4 K~~llL~l   11 (134)
                      |+||+++|
T Consensus         2 k~~~~~~~    9 (124)
T PRK11443          2 KKFIAPLL    9 (124)
T ss_pred             hHHHHHHH
Confidence            55554433


No 173
>KOG4742 consensus Predicted chitinase [General function prediction only]
Probab=22.21  E-value=65  Score=27.33  Aligned_cols=7  Identities=71%  Similarity=1.739  Sum_probs=3.6

Q ss_pred             CCCccCC
Q 032762          106 GRGYYGR  112 (134)
Q Consensus       106 ~~~~~g~  112 (134)
                      .+.||||
T Consensus       171 gk~Y~GR  177 (286)
T KOG4742|consen  171 GKSYYGR  177 (286)
T ss_pred             CCccccc
Confidence            4555553


No 174
>TIGR00842 bcct choline/carnitine/betaine transport. properties inherent to their polypeptide chains.
Probab=22.21  E-value=1.6e+02  Score=26.25  Aligned_cols=19  Identities=32%  Similarity=0.483  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHHHhhhHHH
Q 032762            6 FLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         6 ~llL~l~la~~LlvSSeva   24 (134)
                      +++|.+++.++++++|..+
T Consensus       358 ~~~l~~il~~if~vTs~DS  376 (453)
T TIGR00842       358 TSALALIVIIIFFITSADS  376 (453)
T ss_pred             HHHHHHHHHHHHHHhcchH
Confidence            3334444444444444333


No 175
>PF00737 PsbH:  Photosystem II 10 kDa phosphoprotein;  InterPro: IPR001056 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight phosphoprotein PsbH found in PSII. The phosphorylation site of PsbH is located in the N terminus, where reversible phosphorylation is light-dependent and redox-controlled. PsbH is necessary for the photoprotection of PSII, being required for: (1) the rapid degradation of photodamaged D1 core protein to prevent further oxidative damage to the PSII core, and (2) the insertion of newly synthesised D1 protein into the thylakoid membrane []. PsbH may also regulate the transfer of electrons from D2 (Qa) to D1 (Qb) in the reaction core.; GO: 0042301 phosphate ion binding, 0015979 photosynthesis, 0050821 protein stabilization, 0009523 photosystem II, 0016020 membrane; PDB: 3PRR_H 2AXT_h 3BZ2_H 3BZ1_H 4FBY_W 3PRQ_H 3KZI_H 1S5L_h 3A0H_H 3ARC_H ....
Probab=22.06  E-value=69  Score=20.59  Aligned_cols=9  Identities=44%  Similarity=0.689  Sum_probs=3.9

Q ss_pred             HHHHHHHhh
Q 032762           12 LVSIVLLIS   20 (134)
Q Consensus        12 ~la~~LlvS   20 (134)
                      +|++|+++.
T Consensus        34 lf~vfl~ii   42 (52)
T PF00737_consen   34 LFAVFLLII   42 (52)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            334444443


No 176
>PLN00054 photosystem I reaction center subunit N; Provisional
Probab=22.04  E-value=72  Score=24.23  Aligned_cols=7  Identities=43%  Similarity=0.506  Sum_probs=2.7

Q ss_pred             HHHHhcc
Q 032762           27 DLAETSN   33 (134)
Q Consensus        27 elaE~~~   33 (134)
                      |+.|.+.
T Consensus        58 d~L~kS~   64 (139)
T PLN00054         58 DLLAKSK   64 (139)
T ss_pred             HHHHHhh
Confidence            3333333


No 177
>PRK01622 OxaA-like protein precursor; Validated
Probab=22.00  E-value=85  Score=25.61  Aligned_cols=21  Identities=24%  Similarity=0.279  Sum_probs=10.9

Q ss_pred             chhHHHHHHHHHHHHHHhhhH
Q 032762            2 GSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         2 ~sK~~llL~l~la~~LlvSSe   22 (134)
                      -+|+.+.|+++++++|++|.-
T Consensus         3 ~~~~~~~~~~~~~~~~~~~gc   23 (256)
T PRK01622          3 KSYRAVLVSLSLLLVLVLSGC   23 (256)
T ss_pred             hHHHHHHHHHHHHHHHHHhcc
Confidence            355555555555555555544


No 178
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=21.90  E-value=73  Score=19.62  Aligned_cols=6  Identities=33%  Similarity=0.318  Sum_probs=2.6

Q ss_pred             hHHHHH
Q 032762            4 KVFLML    9 (134)
Q Consensus         4 K~~llL    9 (134)
                      |+++-|
T Consensus         2 ~~~~~~    7 (92)
T TIGR02052         2 KKLATL    7 (92)
T ss_pred             hhHHHH
Confidence            444433


No 179
>PF13999 MarB:  MarB protein
Probab=21.87  E-value=68  Score=21.57  Aligned_cols=7  Identities=43%  Similarity=0.719  Sum_probs=3.2

Q ss_pred             HHHhhhH
Q 032762           16 VLLISSE   22 (134)
Q Consensus        16 ~LlvSSe   22 (134)
                      +||+|.-
T Consensus         8 L~L~SGq   14 (66)
T PF13999_consen    8 LLLFSGQ   14 (66)
T ss_pred             HHHHhhh
Confidence            3445543


No 180
>PRK12450 foldase protein PrsA; Reviewed
Probab=21.87  E-value=86  Score=26.07  Aligned_cols=13  Identities=0%  Similarity=-0.074  Sum_probs=6.3

Q ss_pred             hhHHHHHHHHHHH
Q 032762            3 SKVFLMLGLLVSI   15 (134)
Q Consensus         3 sK~~llL~l~la~   15 (134)
                      .|++|++++++++
T Consensus         4 ~kk~i~~~~~~~~   16 (309)
T PRK12450          4 MNKLITGVVTLAT   16 (309)
T ss_pred             HHHHHHHHHHHHH
Confidence            3555554444333


No 181
>PF07390 P30:  Mycoplasma P30 protein;  InterPro: IPR009975 This family consists of several P30 proteins which seem to be specific to Mycoplasma agalactiae. P30 is a 30 kDa immunodominant antigen and is known to be a transmembrane protein [].
Probab=21.84  E-value=43  Score=27.48  Aligned_cols=20  Identities=30%  Similarity=0.414  Sum_probs=13.3

Q ss_pred             CchhHHHHHHHHHHHHHHhh
Q 032762            1 MGSKVFLMLGLLVSIVLLIS   20 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvS   20 (134)
                      |--|.||+|.-+|++.+-|.
T Consensus         1 MK~k~lL~LGT~ltatfSiP   20 (266)
T PF07390_consen    1 MKLKLLLNLGTALTATFSIP   20 (266)
T ss_pred             CchhhhhhhhhHhhhhcccc
Confidence            76778888877666644443


No 182
>TIGR00156 conserved hypothetical protein TIGR00156. As of the last revision, this family consists only of two proteins from Escherichia coli and one from the related species Haemophilus influenzae.
Probab=21.65  E-value=87  Score=23.34  Aligned_cols=6  Identities=17%  Similarity=0.213  Sum_probs=2.4

Q ss_pred             hHHHHH
Q 032762            4 KVFLML    9 (134)
Q Consensus         4 K~~llL    9 (134)
                      |+++++
T Consensus         2 KK~~~~    7 (126)
T TIGR00156         2 KFQAIV    7 (126)
T ss_pred             chHHHH
Confidence            444433


No 183
>PRK12587 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=21.55  E-value=1.9e+02  Score=21.21  Aligned_cols=16  Identities=19%  Similarity=0.223  Sum_probs=8.5

Q ss_pred             HHHHHHHhhhHHHHHH
Q 032762           12 LVSIVLLISSEAAARD   27 (134)
Q Consensus        12 ~la~~LlvSSevaAre   27 (134)
                      ++.+|+++++.+++--
T Consensus        73 l~~~f~~lT~Pvaah~   88 (118)
T PRK12587         73 VGIIFVLITGPLSSHM   88 (118)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3344556666665433


No 184
>KOG4251 consensus Calcium binding protein [General function prediction only]
Probab=21.53  E-value=26  Score=29.81  Aligned_cols=28  Identities=36%  Similarity=0.474  Sum_probs=13.5

Q ss_pred             CchhHHHHHH------HHHHHHHHhhhHHHHHHHHH
Q 032762            1 MGSKVFLMLG------LLVSIVLLISSEAAARDLAE   30 (134)
Q Consensus         1 M~sK~~llL~------l~la~~LlvSSevaArelaE   30 (134)
                      |||++--|++      -||++|++++  ++|+++.-
T Consensus         8 masrwgpliglapcclwLLgavllmd--AsarPaNh   41 (362)
T KOG4251|consen    8 MASRWGPLIGLAPCCLWLLGAVLLMD--ASARPANH   41 (362)
T ss_pred             HHhhccchhchHHHHHHHHHHHHHhh--hhcCcccc
Confidence            7787643322      2344444443  45565543


No 185
>PRK06778 hypothetical protein; Validated
Probab=21.50  E-value=1e+02  Score=25.65  Aligned_cols=9  Identities=0%  Similarity=0.076  Sum_probs=3.8

Q ss_pred             HHHHHHhcc
Q 032762           25 ARDLAETSN   33 (134)
Q Consensus        25 ArelaE~~~   33 (134)
                      .+++++..+
T Consensus        51 ~~~~~~s~~   59 (289)
T PRK06778         51 RESIIAALH   59 (289)
T ss_pred             HHHHHHHhc
Confidence            344444443


No 186
>PRK15206 long polar fimbrial protein LpfD; Provisional
Probab=21.49  E-value=70  Score=27.76  Aligned_cols=17  Identities=41%  Similarity=0.530  Sum_probs=7.0

Q ss_pred             CchhHHHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSIVL   17 (134)
Q Consensus         1 M~sK~~llL~l~la~~L   17 (134)
                      |=.|+++++.||+.++|
T Consensus         1 ~~~k~~~~~~~l~~~~~   17 (359)
T PRK15206          1 MLKKLMMFTGLLGGSVL   17 (359)
T ss_pred             ChHHHHHHHHHHHHHHH
Confidence            43444444444443333


No 187
>PRK10510 putative outer membrane lipoprotein; Provisional
Probab=21.46  E-value=78  Score=25.22  Aligned_cols=20  Identities=25%  Similarity=0.248  Sum_probs=11.5

Q ss_pred             hhHHHHHHHHHHHHHHhhhH
Q 032762            3 SKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         3 sK~~llL~l~la~~LlvSSe   22 (134)
                      .|+++.+++++++.|++++-
T Consensus         2 ~~~~~~~~~~~~~~~~lsgC   21 (219)
T PRK10510          2 KKRVYLIAAVVSGALAVSGC   21 (219)
T ss_pred             cccHHHHHHHHHHHHHHhcc
Confidence            35566666666665655543


No 188
>TIGR03043 PS_II_psbZ photosystem II core protein PsbZ. PsbZ is a core protein of photosystem II in thylakoid-containing Cyanobacteria and plant chloroplasts. The original Chlamydomonas gene symbol, ycf9, is a synonym. PsbZ controls the interaction of the reaction center core with the light-harvesting antenna.
Probab=21.43  E-value=1e+02  Score=20.15  Aligned_cols=17  Identities=18%  Similarity=0.344  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 032762            5 VFLMLGLLVSIVLLISS   21 (134)
Q Consensus         5 ~~llL~l~la~~LlvSS   21 (134)
                      ++++++|++..|+++..
T Consensus         3 Ql~v~aLi~~Sf~LVVg   19 (58)
T TIGR03043         3 QLAVLALVLLSFVLVVG   19 (58)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            45666666666666543


No 189
>PRK12670 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=21.23  E-value=2e+02  Score=20.29  Aligned_cols=20  Identities=40%  Similarity=0.474  Sum_probs=10.5

Q ss_pred             HHHHHHHHhhhHHHHHHHHH
Q 032762           11 LLVSIVLLISSEAAARDLAE   30 (134)
Q Consensus        11 l~la~~LlvSSevaArelaE   30 (134)
                      +++.+|+++.+.+++.-++.
T Consensus        66 lli~~f~~lT~Pvaah~iar   85 (99)
T PRK12670         66 LLLICLLWITSTTASYALAR   85 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            33444566666666544433


No 190
>PRK13871 conjugal transfer protein TrbC; Provisional
Probab=21.15  E-value=96  Score=23.58  Aligned_cols=9  Identities=33%  Similarity=0.397  Sum_probs=5.7

Q ss_pred             CchhHHHHH
Q 032762            1 MGSKVFLML    9 (134)
Q Consensus         1 M~sK~~llL    9 (134)
                      |..|+.+++
T Consensus         1 m~~k~~~~~    9 (135)
T PRK13871          1 MSRKTRITL    9 (135)
T ss_pred             CchhHHHHH
Confidence            766776643


No 191
>PF01737 Ycf9:  YCF9;  InterPro: IPR002644 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents PsbZ (Ycf9), which is a core low molecular weight transmembrane protein of photosystem II in thylakoid-containing chloroplasts of cyanobacteria and plants. It is thought to be located at the interface of PSII and LHCII (light-harvesting complex II) complexes, the latter containing the light-harvesting antenna. PsbZ appears to act as a structural factor, or linker, that stabilises the PSII-LHCII supercomplexes, which fail to form in PsbZ-deficient mutants. This may in part be due to the marked decrease in two LHCII antenna proteins, CP26 and CP29, found in PsbZ-deficient mutants, which result in structural changes, as well as functional modifications in PSII []. PsbZ may also be involved in photo-protective processes under sub-optimal growth conditions.; GO: 0015979 photosynthesis, 0042549 photosystem II stabilization, 0009523 photosystem II, 0009539 photosystem II reaction center; PDB: 3A0B_Z 3ARC_Z 3A0H_Z 3PRQ_Z 4FBY_l 2AXT_z 3PRR_Z 3BZ1_Z 3KZI_Z 1S5L_Z ....
Probab=21.08  E-value=1.1e+02  Score=20.09  Aligned_cols=17  Identities=18%  Similarity=0.335  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 032762            5 VFLMLGLLVSIVLLISS   21 (134)
Q Consensus         5 ~~llL~l~la~~LlvSS   21 (134)
                      ++++++|++..|+++..
T Consensus         3 Ql~v~aLi~~Sf~LVVg   19 (59)
T PF01737_consen    3 QLAVFALIALSFLLVVG   19 (59)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45666666666665543


No 192
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=20.93  E-value=1.4e+02  Score=16.94  Aligned_cols=9  Identities=22%  Similarity=0.087  Sum_probs=3.8

Q ss_pred             HHHHHHHHH
Q 032762            6 FLMLGLLVS   14 (134)
Q Consensus         6 ~llL~l~la   14 (134)
                      +|.++|+++
T Consensus        11 ~ly~~l~~~   19 (29)
T TIGR03063        11 GLYAVLFLG   19 (29)
T ss_pred             HHHHHHHHH
Confidence            444444443


No 193
>PF15281 Consortin_C:  Consortin C-terminus
Probab=20.87  E-value=83  Score=23.22  Aligned_cols=14  Identities=36%  Similarity=0.572  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHHHhh
Q 032762            7 LMLGLLVSIVLLIS   20 (134)
Q Consensus         7 llL~l~la~~LlvS   20 (134)
                      |+|+||..++|++|
T Consensus        55 l~L~LlclvTv~lS   68 (113)
T PF15281_consen   55 LLLLLLCLVTVVLS   68 (113)
T ss_pred             HHHHHHHHHHHHHh
Confidence            34444444555554


No 194
>PF06404 PSK:  Phytosulfokine precursor protein (PSK);  InterPro: IPR009438 This family consists of several plant specific phytosulfokine precursor proteins. Phytosulfokines, are active as either a pentapeptide or a C-terminally truncated tetrapeptide. These compounds were first isolated because of their ability to stimulate cell division in somatic embryo cultures of Asparagus officinalis [].; GO: 0008083 growth factor activity, 0008283 cell proliferation, 0005576 extracellular region
Probab=20.69  E-value=28  Score=23.98  Aligned_cols=10  Identities=60%  Similarity=0.640  Sum_probs=5.2

Q ss_pred             hhHHHHHHHH
Q 032762           20 SSEAAARDLA   29 (134)
Q Consensus        20 SSevaArela   29 (134)
                      ++..+||++-
T Consensus        10 ~~~~AARp~p   19 (81)
T PF06404_consen   10 TSAAAARPLP   19 (81)
T ss_pred             hHhhhcCCCC
Confidence            3345566643


No 195
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=20.66  E-value=1.5e+02  Score=18.91  Aligned_cols=7  Identities=29%  Similarity=0.861  Sum_probs=3.6

Q ss_pred             hHHHHHH
Q 032762            4 KVFLMLG   10 (134)
Q Consensus         4 K~~llL~   10 (134)
                      +++|+|+
T Consensus         6 Rs~L~~~   12 (54)
T PF06716_consen    6 RSYLLLA   12 (54)
T ss_pred             HHHHHHH
Confidence            4555543


No 196
>COG3637 Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane]
Probab=20.66  E-value=94  Score=24.22  Aligned_cols=8  Identities=25%  Similarity=0.206  Sum_probs=3.5

Q ss_pred             hHHHHHHH
Q 032762            4 KVFLMLGL   11 (134)
Q Consensus         4 K~~llL~l   11 (134)
                      |.+|++++
T Consensus         2 k~~l~~a~    9 (199)
T COG3637           2 KKLLAAAA    9 (199)
T ss_pred             hhHHHHHH
Confidence            44444444


No 197
>PRK13792 lysozyme inhibitor; Provisional
Probab=20.59  E-value=70  Score=23.88  Aligned_cols=8  Identities=25%  Similarity=0.243  Sum_probs=3.3

Q ss_pred             hHHHHHHH
Q 032762            4 KVFLMLGL   11 (134)
Q Consensus         4 K~~llL~l   11 (134)
                      |+|++|.+
T Consensus         3 ~~l~~ll~   10 (127)
T PRK13792          3 KALWLLLA   10 (127)
T ss_pred             hHHHHHHH
Confidence            45443333


No 198
>PF01998 DUF131:  Protein of unknown function DUF131;  InterPro: IPR002849 This archaebacterial protein family has no known function. The proteins are predicted to contain two transmembrane helices.
Probab=20.59  E-value=1.2e+02  Score=20.06  Aligned_cols=14  Identities=14%  Similarity=0.446  Sum_probs=6.2

Q ss_pred             hHHHHHHHHHHHHH
Q 032762            4 KVFLMLGLLVSIVL   17 (134)
Q Consensus         4 K~~llL~l~la~~L   17 (134)
                      +.+..++++||+++
T Consensus        42 ~~~~~~~~ilaiil   55 (64)
T PF01998_consen   42 PRIAKIAMILAIIL   55 (64)
T ss_pred             HHHHHHHHHHHHHH
Confidence            44444444444433


No 199
>CHL00190 psaM photosystem I subunit XII; Provisional
Probab=20.55  E-value=1.8e+02  Score=16.55  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=7.9

Q ss_pred             CchhHHHHHHHHHHH
Q 032762            1 MGSKVFLMLGLLVSI   15 (134)
Q Consensus         1 M~sK~~llL~l~la~   15 (134)
                      |-|-.-++++|++|+
T Consensus         1 misd~Qi~iAL~~Al   15 (30)
T CHL00190          1 MISDSQIFIALFLAL   15 (30)
T ss_pred             CchHHHHHHHHHHHH
Confidence            445444555665544


No 200
>PRK11546 zraP zinc resistance protein; Provisional
Probab=20.51  E-value=1.3e+02  Score=22.98  Aligned_cols=15  Identities=27%  Similarity=0.153  Sum_probs=7.3

Q ss_pred             HHHHHHHhhhHHHHH
Q 032762           12 LVSIVLLISSEAAAR   26 (134)
Q Consensus        12 ~la~~LlvSSevaAr   26 (134)
                      .||+++++|+.+.|+
T Consensus        13 ala~~~~~s~~a~A~   27 (143)
T PRK11546         13 ALSALAMGSGSAFAH   27 (143)
T ss_pred             HHHHHHHhhhHHHHh
Confidence            334444555555444


No 201
>PF12988 DUF3872:  Domain of unknown function, B. Theta Gene description (DUF3872);  InterPro: IPR024355 This entry represents proteins of unknown function found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene coding for this protein is located in a conjugate transposon and appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].; PDB: 2L3B_A 2L7Q_A.
Probab=20.42  E-value=34  Score=26.08  Aligned_cols=22  Identities=32%  Similarity=0.452  Sum_probs=0.0

Q ss_pred             CchhHHHHHHHHHHHHHHhhhH
Q 032762            1 MGSKVFLMLGLLVSIVLLISSE   22 (134)
Q Consensus         1 M~sK~~llL~l~la~~LlvSSe   22 (134)
                      |=.|.++++.+++|+++|.|.+
T Consensus         1 ~~~~i~~~~~~~~~~~~l~sC~   22 (137)
T PF12988_consen    1 MIQKIIIGCCLLLALLLLSSCD   22 (137)
T ss_dssp             ----------------------
T ss_pred             CHHHHHHHHHHHHHHHHHhhcC
Confidence            4455556666666666665553


No 202
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795).
Probab=20.42  E-value=61  Score=24.53  Aligned_cols=11  Identities=45%  Similarity=0.781  Sum_probs=4.2

Q ss_pred             HHHHHHHHHHh
Q 032762            9 LGLLVSIVLLI   19 (134)
Q Consensus         9 L~l~la~~Llv   19 (134)
                      |.|+++++|++
T Consensus         4 ~~~~~~~~~~~   14 (235)
T TIGR03302         4 LILLLALLLLL   14 (235)
T ss_pred             HHHHHHHHHHH
Confidence            33333343433


No 203
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=20.35  E-value=1.7e+02  Score=21.96  Aligned_cols=10  Identities=30%  Similarity=0.557  Sum_probs=4.3

Q ss_pred             hHHHHHHHHH
Q 032762            4 KVFLMLGLLV   13 (134)
Q Consensus         4 K~~llL~l~l   13 (134)
                      ++||.|+|+|
T Consensus         3 ~~~~~~~~~~   12 (153)
T TIGR02738         3 RKLLIVLLLL   12 (153)
T ss_pred             hHHHHHHHHH
Confidence            3444444433


No 204
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=20.32  E-value=77  Score=21.17  Aligned_cols=10  Identities=10%  Similarity=0.288  Sum_probs=3.8

Q ss_pred             HHHHHHHHHH
Q 032762            8 MLGLLVSIVL   17 (134)
Q Consensus         8 lL~l~la~~L   17 (134)
                      ||+|++|++|
T Consensus        10 liIlvI~lll   19 (67)
T PRK03625         10 LVVAALVVLL   19 (67)
T ss_pred             HHHHHHHHHH
Confidence            3334333433


No 205
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=20.30  E-value=95  Score=24.61  Aligned_cols=7  Identities=29%  Similarity=0.562  Sum_probs=2.7

Q ss_pred             HHHHHHh
Q 032762           13 VSIVLLI   19 (134)
Q Consensus        13 la~~Llv   19 (134)
                      |+++|++
T Consensus        10 liis~fl   16 (182)
T COG2143          10 LIISLFL   16 (182)
T ss_pred             HHHHHHH
Confidence            3344433


No 206
>PLN02196 abscisic acid 8'-hydroxylase
Probab=20.12  E-value=86  Score=26.81  Aligned_cols=19  Identities=11%  Similarity=0.172  Sum_probs=11.3

Q ss_pred             CchhHHHHHHHHHHHHHHh
Q 032762            1 MGSKVFLMLGLLVSIVLLI   19 (134)
Q Consensus         1 M~sK~~llL~l~la~~Llv   19 (134)
                      |.|.+++++++++++||++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~   19 (463)
T PLN02196          1 MDFSALFLTLFAGALFLCL   19 (463)
T ss_pred             CchHhhhhHHHHHHHHHHH
Confidence            7777766655555555544


No 207
>PRK08055 chorismate mutase; Provisional
Probab=20.06  E-value=1.4e+02  Score=23.39  Aligned_cols=6  Identities=0%  Similarity=-0.058  Sum_probs=2.3

Q ss_pred             HhhhHH
Q 032762           18 LISSEA   23 (134)
Q Consensus        18 lvSSev   23 (134)
                      ++|..+
T Consensus        17 ~~~~~~   22 (181)
T PRK08055         17 AFALAV   22 (181)
T ss_pred             HHHhHH
Confidence            333333


No 208
>PRK09950 putative transporter; Provisional
Probab=20.01  E-value=2e+02  Score=26.13  Aligned_cols=19  Identities=37%  Similarity=0.366  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHhhhHHH
Q 032762            6 FLMLGLLVSIVLLISSEAA   24 (134)
Q Consensus         6 ~llL~l~la~~LlvSSeva   24 (134)
                      +++|.+++.++++++|..+
T Consensus       404 ~~~l~~vl~~if~vTs~DS  422 (506)
T PRK09950        404 FLAAYLGIMIIFLASHMDA  422 (506)
T ss_pred             HHHHHHHHHHHHHHHhhhH
Confidence            3344444444444444333


Done!