Citrus Sinensis ID: 032773


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MARSLRMLRILYRNVSLSSSASLPASFSFLSCRASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLMRYREMEGDTKGSARGGDGSAKRDTIGALPGQNAQYALQGPLNYANPHVTFSLLHLISFLLTN
cccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHccccccc
******MLRILYRNVSLSSSASLPASFSFLSCRASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLMRYR************************************PLNY*NPHVTFSLLHLI*FLL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSLRMLRILYRNVSLSSSASLPASFSFLSCRASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLMRYREMEGDTKGSARGGDGSAKRDTIGALPGQNAQYALQGPLNYANPHVTFSLLHLISFLLTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transcription factor Y subunit B-3 Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development.probableQ60EQ4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N1J, chain A
Confidence level:very confident
Coverage over the Query: 1-76
View the alignment between query and template
View the model in PyMOL