Query         032775
Match_columns 134
No_of_seqs    156 out of 1329
Neff          7.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:48:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032775.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032775hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0537 Cytochrome b5 [Energy  100.0 7.9E-34 1.7E-38  201.2   5.1  120    4-131     3-122 (124)
  2 PF00173 Cyt-b5:  Cytochrome b5  99.9 1.6E-25 3.4E-30  144.9   4.6   75    7-81      1-76  (76)
  3 KOG0536 Flavohemoprotein b5+b5  99.9 2.4E-23 5.2E-28  147.6   6.8   77    6-82     68-144 (145)
  4 PLN03199 delta6-acyl-lipid des  99.8 3.1E-21 6.7E-26  163.1   9.9   80    4-86     22-101 (485)
  5 PLN03198 delta6-acyl-lipid des  99.8   1E-21 2.2E-26  167.3   6.4   78    5-84    103-180 (526)
  6 COG5274 CYB5 Cytochrome b invo  99.8 4.5E-21 9.7E-26  140.8   5.3   79    5-83     49-127 (164)
  7 PLN02252 nitrate reductase [NA  99.8 2.1E-20 4.6E-25  167.0   7.5   81    4-85    516-596 (888)
  8 KOG4576 Sulfite oxidase, heme-  99.7 2.1E-17 4.6E-22  117.9   1.9   84    4-87     78-163 (167)
  9 KOG4232 Delta 6-fatty acid des  99.6 3.6E-16 7.8E-21  128.8   5.3   78    5-84      7-86  (430)
 10 COG4892 Predicted heme/steroid  98.7 2.1E-08 4.5E-13   64.3   4.7   75    6-83      2-78  (81)
 11 KOG1110 Putative steroid membr  97.8 0.00011 2.4E-09   55.1   7.9   55    4-60     54-112 (183)
 12 KOG1108 Predicted heme/steroid  96.7 0.00092   2E-08   52.2   1.8   56    4-61     58-117 (281)
 13 PF14901 Jiv90:  Cleavage induc  90.4    0.16 3.5E-06   34.4   1.5   13   25-37     60-72  (94)
 14 KOG0720 Molecular chaperone (D  71.0     2.3 5.1E-05   36.4   1.4   15   23-37    380-394 (490)
 15 PRK14758 hypothetical protein;  67.2      15 0.00032   19.0   3.4   22  111-132     6-27  (27)
 16 COG3424 BcsA Predicted naringe  62.7     4.5 9.8E-05   33.3   1.5   38   39-83    276-314 (356)
 17 PRK00159 putative septation in  59.1      30 0.00065   23.1   4.7   19  114-132    36-54  (87)
 18 PF06781 UPF0233:  Uncharacteri  58.8      26 0.00056   23.3   4.4   20  114-133    36-55  (87)
 19 PF11698 V-ATPase_H_C:  V-ATPas  58.0    0.67 1.5E-05   32.7  -3.5   27   30-56     65-91  (119)
 20 PF02797 Chal_sti_synt_C:  Chal  53.8       5 0.00011   29.2   0.4   15   38-52     64-78  (151)
 21 TIGR02148 Fibro_Slime fibro-sl  50.5      18 0.00039   24.3   2.6   22   15-36     23-45  (90)
 22 PRK02251 putative septation in  48.8      53  0.0012   21.9   4.6   19  114-132    37-55  (87)
 23 cd00256 VATPase_H VATPase_H, r  48.2       4 8.6E-05   34.7  -1.0   35   20-56    367-401 (429)
 24 PRK06549 acetyl-CoA carboxylas  39.7      22 0.00047   25.3   1.8   14   21-34      4-17  (130)
 25 CHL00008 petG cytochrome b6/f   36.7      55  0.0012   18.2   2.7   17  115-131    13-30  (37)
 26 PRK00665 petG cytochrome b6-f   36.1      58  0.0013   18.2   2.7   16  115-130    13-29  (37)
 27 PHA02131 hypothetical protein   36.1      31 0.00068   21.3   1.8   15   21-35     30-45  (70)
 28 PHA02844 putative transmembran  33.0      84  0.0018   20.3   3.5   10  110-119    47-56  (75)
 29 PHA02975 hypothetical protein;  32.7      81  0.0018   20.1   3.4    9  111-119    44-52  (69)
 30 TIGR03147 cyt_nit_nrfF cytochr  32.6      53  0.0012   23.3   2.8   20  109-128   100-119 (126)
 31 PF05521 Phage_H_T_join:  Phage  32.1      53  0.0011   20.5   2.6   18   20-37     65-82  (95)
 32 PF11044 TMEMspv1-c74-12:  Plec  32.1      82  0.0018   18.5   3.1   19  110-128     3-21  (49)
 33 PHA02819 hypothetical protein;  32.0      90  0.0019   20.0   3.5   10  110-119    45-54  (71)
 34 PF04375 HemX:  HemX;  InterPro  31.8 1.4E+02   0.003   24.7   5.6   11  120-130    40-50  (372)
 35 PHA02650 hypothetical protein;  31.5      85  0.0018   20.6   3.4   10  110-119    48-57  (81)
 36 PF12669 P12:  Virus attachment  31.1      35 0.00076   20.8   1.5   17  115-131     3-21  (58)
 37 KOG2759 Vacuolar H+-ATPase V1   28.7      15 0.00032   31.3  -0.6   33   20-54    380-412 (442)
 38 PF02529 PetG:  Cytochrome B6-F  28.7      86  0.0019   17.5   2.7   18  115-132    13-31  (37)
 39 PHA03054 IMV membrane protein;  27.8      91   0.002   20.0   3.0   10  110-119    47-56  (72)
 40 PF06024 DUF912:  Nucleopolyhed  27.2      85  0.0019   21.1   3.1   11  120-130    74-84  (101)
 41 PF03918 CcmH:  Cytochrome C bi  27.1      20 0.00044   26.0  -0.1   21  108-128    99-119 (148)
 42 COG3197 FixS Uncharacterized p  25.6      82  0.0018   19.4   2.4   15  114-128     6-20  (58)
 43 PF11093 Mitochondr_Som1:  Mito  24.8      40 0.00088   22.2   1.0   16    1-16      1-16  (83)
 44 COG4858 Uncharacterized membra  24.4      64  0.0014   24.8   2.2   18  116-133   196-214 (226)
 45 PF10618 Tail_tube:  Phage tail  24.0      61  0.0013   22.5   1.9   25   20-44      7-31  (119)
 46 PF13260 DUF4051:  Protein of u  22.9 1.5E+02  0.0033   17.6   3.1   14  111-125     5-18  (54)
 47 PF04415 DUF515:  Protein of un  22.3 1.8E+02   0.004   24.8   4.7   20  113-132    36-55  (416)
 48 PF15086 UPF0542:  Uncharacteri  22.1 2.1E+02  0.0045   18.5   3.9   22  107-128    22-43  (74)
 49 PRK10144 formate-dependent nit  21.2 1.1E+02  0.0024   21.7   2.8   15  109-123   100-114 (126)
 50 PF13633 N_methyl_3:  Prokaryot  20.7 1.3E+02  0.0028   14.9   2.4   16  111-126     3-18  (22)
 51 PF15018 InaF-motif:  TRP-inter  20.5 1.8E+02  0.0038   16.3   3.4   21  110-130     9-29  (38)

No 1  
>KOG0537 consensus Cytochrome b5 [Energy production and conversion]
Probab=100.00  E-value=7.9e-34  Score=201.23  Aligned_cols=120  Identities=47%  Similarity=0.782  Sum_probs=95.0

Q ss_pred             CCCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCCC
Q 032775            4 DPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      .++.||.+||++||+.+||||+|+|+|||||+|+++||||.++|+.+||+|+|+.|++.+||.+|++||++|+||.+...
T Consensus         3 ~~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~~   82 (124)
T KOG0537|consen    3 DLKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPTT   82 (124)
T ss_pred             ccccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccCC
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999887


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCchHHHHHHHHHHHHHHHHHHHHHHHhh
Q 032775           84 TVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLILGLAFAVRHYT  131 (134)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (134)
                      ..+......        ..........+..+.+.++++.+++.++.+.
T Consensus        83 ~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  122 (124)
T KOG0537|consen   83 ARPVVWSNT--------AGYEVDRLTVSGGLLVAILILPLQEHILGLT  122 (124)
T ss_pred             Cccceeccc--------cccccccccccccceeeeeechhhhhhhhcc
Confidence            765543222        1111111222333556666666655555443


No 2  
>PF00173 Cyt-b5:  Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry;  InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts []. The microsomal and mitochondrial variants are membrane-bound, while those from erythrocytes and other animal tissues are water-soluble [, ]. The 3D structure of bovine cyt b5 is known, the fold belonging to the alpha+beta class, with 5 strands and 5 short helices forming a framework for supporting a central haem group []. The cytochrome b5 domain is similar to that of a number of oxidoreductases, such as plant and fungal nitrate reductases, sulphite oxidase, yeast flavocytochrome b2 (L-lactate dehydrogenase) and plant cyt b5/acyl lipid desaturase fusion protein.; GO: 0020037 heme binding; PDB: 2I96_A 3KS0_A 1KBI_B 1KBJ_B 1LTD_A 1SZG_B 1SZF_A 1LDC_B 2OZ0_B 1LCO_A ....
Probab=99.92  E-value=1.6e-25  Score=144.89  Aligned_cols=75  Identities=49%  Similarity=0.921  Sum_probs=69.8

Q ss_pred             CcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhc-CeeEEeC
Q 032775            7 IHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDK-YYIGDID   81 (134)
Q Consensus         7 ~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~-~~VG~l~   81 (134)
                      +||++||++|++.++|||+|+|+|||||+|+..||||..++..++|+|+|+.|....|+..+.++|+. |+||+|+
T Consensus         1 ~~t~~el~~h~~~~~~~v~i~g~VYDvt~~~~~hpgg~~~~~~~aG~D~T~~f~~~~h~~~~~~~l~~~~~vG~ld   76 (76)
T PF00173_consen    1 VYTWEELAKHNKKGDCWVIIDGKVYDVTDFLDRHPGGADILKKYAGRDATDAFEEAFHSWWAEKCLEKYYKVGYLD   76 (76)
T ss_dssp             EEEHHHHTTTEETTEEEEEETTEEEECTTTTTTSTTTSHHHHTTTTSBTHHHHHHHTHHHHHHHHHHGCGEEEEE-
T ss_pred             CCCHHHHhhhCCCCCEEEEECCEEcccccccccccchhHHHHHhccccccHHHhhccCcHHHHHHccCCCEEEEeC
Confidence            48999999999999999999999999999999999999999999999999999445699999999998 9999985


No 3  
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion]
Probab=99.89  E-value=2.4e-23  Score=147.58  Aligned_cols=77  Identities=36%  Similarity=0.672  Sum_probs=73.0

Q ss_pred             CCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCC
Q 032775            6 KIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDP   82 (134)
Q Consensus         6 ~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~   82 (134)
                      ..+|.+||++|++.+|||++|+|+|||||.|++.||||.+.|+.++|+|+|..|+.+|-..+-.++|+.+.||.+.+
T Consensus        68 i~vt~~El~KH~~~dDcW~~i~G~VYnVt~Yl~fHPgG~d~lmk~aGrD~T~~Fnk~H~WVN~e~LL~~c~VGvl~d  144 (145)
T KOG0536|consen   68 IPVTAEELKKHNKKDDCWIAIRGKVYNVTAYLDFHPGGVDELMKHAGRDATKLFNKYHAWVNYEELLKKCFVGVLVD  144 (145)
T ss_pred             CccCHHHHHhhCCccceEEEEcCEEEecccccccCCCCHHHHHHhcCcchHHHHHHHHHHhcHHHHHhhceeeeecc
Confidence            46899999999999999999999999999999999999999999999999999999877788889999999998864


No 4  
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=99.85  E-value=3.1e-21  Score=163.06  Aligned_cols=80  Identities=39%  Similarity=0.796  Sum_probs=73.5

Q ss_pred             CCCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCCC
Q 032775            4 DPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      ..+.+|++||++|+++++|||+|+|+|||||+|+ +||||. +|+.++|+|+|+.|+.. |+..++++|++|+||+++++
T Consensus        22 ~~~~~s~~ev~~h~~~~~~wi~i~g~vYDvt~f~-~HPGG~-~i~~~aG~DaT~~F~~~-H~~~~~~~l~~~~iG~l~~~   98 (485)
T PLN03199         22 KPQKISWQEVKKHASPDDAWIIHQNKVYDVSNWH-DHPGGA-VIFTHAGDDMTDIFAAF-HAPGSQALMKKFYIGDLIPE   98 (485)
T ss_pred             cCCccCHHHHHhhCCCCCeEEEECCEEEcCCCcC-cCCCch-HHHhhCCCChhHHHHHh-cCHHHHHHHHhccccccccc
Confidence            4678999999999999999999999999999997 899998 78899999999999985 99999999999999999765


Q ss_pred             CCC
Q 032775           84 TVP   86 (134)
Q Consensus        84 ~~~   86 (134)
                      +.+
T Consensus        99 ~~~  101 (485)
T PLN03199         99 STE  101 (485)
T ss_pred             ccc
Confidence            543


No 5  
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=99.85  E-value=1e-21  Score=167.33  Aligned_cols=78  Identities=45%  Similarity=0.907  Sum_probs=73.0

Q ss_pred             CCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCCCC
Q 032775            5 PKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPST   84 (134)
Q Consensus         5 ~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~~   84 (134)
                      .+.||++|+++|++.+||||+|+|+|||||+|+++||||. +|..++|+|+|+.|+.. |+..+.++|++|+||+++..+
T Consensus       103 ~~~~t~~ev~~H~~~~d~Wivi~gkVYDvT~fl~~HPGG~-~i~~~aG~DaT~~F~~~-H~~~~~~~l~~~~IG~l~~~~  180 (526)
T PLN03198        103 SKSHLLSEVAAHNKPNDCWIVIKNKVYDVSDFAAEHPGGS-VISTYFGRDGTDAFSSF-HAASTWKILQDFYIGDVDNVE  180 (526)
T ss_pred             cCcCCHHHHHhhCCCCCeEEEECCEEEecHHHHHhCCCch-HHHHhcCCcHhHHHHHh-cCHHHHHHHhhCcceecCCcc
Confidence            3599999999999999999999999999999999999998 89999999999999986 999999999999999997643


No 6  
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism]
Probab=99.83  E-value=4.5e-21  Score=140.76  Aligned_cols=79  Identities=44%  Similarity=0.894  Sum_probs=75.7

Q ss_pred             CCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCCC
Q 032775            5 PKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus         5 ~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      .+.++.+||.+|++.++|||+|+|+|||||.|+++||||.++|+.++|+|+|+.|...+|+..+.++++.++||.+...
T Consensus        49 ~~~~~~eev~~h~~~~d~~ivi~g~VyDvs~fl~~HPGGe~ii~~~~g~Dat~~f~~~~~~~~~~~llk~~yv~~v~r~  127 (164)
T COG5274          49 PKPITAEEVAKHNKSEDCWIVINGKVYDVSQFLDEHPGGEDIIKDTAGKDATKAFNFLHHSHQIGNLLKDVYVDQVHRP  127 (164)
T ss_pred             cccccHHHHHHhcCccceEEEEcCEEEEhhhccccCCCcceeehhccCchhhhhhcccccchhHHhhhhceeeecccCc
Confidence            4678999999999999999999999999999999999999999999999999999999999999999999999999765


No 7  
>PLN02252 nitrate reductase [NADPH]
Probab=99.82  E-value=2.1e-20  Score=167.00  Aligned_cols=81  Identities=36%  Similarity=0.843  Sum_probs=76.3

Q ss_pred             CCCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHHHHHhhhcCeeEEeCCC
Q 032775            4 DPKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      ..+.||++||++|++.++|||+|+|+|||+|+|++.||||.++|+.++|+|+|+.|+.+ |+..|+++|++|+||+|...
T Consensus       516 ~~~~~t~~ev~~h~~~~~~Wivi~g~VYDvT~fl~~HPGG~~~I~~~aG~DaT~~F~~~-Hs~~a~~~L~~~~IG~l~~~  594 (888)
T PLN02252        516 GSKQYTMSEVRKHNSEDSCWIVVHGHVYDCTRFLKDHPGGADSILINAGTDCTEEFDAI-HSDKAKKMLEDYRIGELVTT  594 (888)
T ss_pred             ccceeCHHHHHhhCcCCCeEEEECCEEEeCHHHHHHCCChHHHHHhhcCCCcHHHHhhh-hhHHHHHHHHhCcCCccccc
Confidence            35789999999999999999999999999999999999999999999999999999986 99999999999999999766


Q ss_pred             CC
Q 032775           84 TV   85 (134)
Q Consensus        84 ~~   85 (134)
                      ..
T Consensus       595 ~~  596 (888)
T PLN02252        595 GA  596 (888)
T ss_pred             cc
Confidence            54


No 8  
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion]
Probab=99.66  E-value=2.1e-17  Score=117.89  Aligned_cols=84  Identities=32%  Similarity=0.609  Sum_probs=73.8

Q ss_pred             CCCCcCHHHHhcccCCC-CeEEEEcCEEEeccccCCCCCChHHHHHHhhCC-CCchhhhhcCCCHHHHHhhhcCeeEEeC
Q 032775            4 DPKIHQFEEVATHNKTK-DCWLIISGKVYDVSSFMDDHPGGDEVLISATGK-DATNDFEDVGHSDSAREMMDKYYIGDID   81 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~-~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~-D~T~~f~~~~Hs~~a~~~l~~~~VG~l~   81 (134)
                      .+++|+.+||++|+++. ..||.+...|||||+|++.||||+++++.+.|. |..+.....|.+..++++|+.|+||+++
T Consensus        78 ~l~iY~~EEV~~H~s~e~rIWVTyg~gVyDVTdFv~~HPGGdKillAAG~a~dPFWalY~qHnt~eVlElLegyrIG~L~  157 (167)
T KOG4576|consen   78 SLHIYTKEEVSSHTSPETRIWVTYGSGVYDVTDFVDLHPGGDKILLAAGGALDPFWALYAQHNTSEVLELLEGYRIGELN  157 (167)
T ss_pred             hccchhHHHHHhcCCCccceEEEecCcceeHHHHHHhCCCcceeeeecCCCcCcHHHHHHHhhHHHHHHHHhhcccccCC
Confidence            47899999999999876 599999999999999999999998888766554 8788878778888999999999999999


Q ss_pred             CCCCCC
Q 032775           82 PSTVPR   87 (134)
Q Consensus        82 ~~~~~~   87 (134)
                      +.+++.
T Consensus       158 ~~dv~~  163 (167)
T KOG4576|consen  158 PEDVVA  163 (167)
T ss_pred             hhhccc
Confidence            887654


No 9  
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism]
Probab=99.62  E-value=3.6e-16  Score=128.79  Aligned_cols=78  Identities=36%  Similarity=0.761  Sum_probs=71.2

Q ss_pred             CCCcCHHHHhcccCCCCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhhcCCCHH--HHHhhhcCeeEEeCC
Q 032775            5 PKIHQFEEVATHNKTKDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDS--AREMMDKYYIGDIDP   82 (134)
Q Consensus         5 ~~~~t~~ev~~h~~~~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~--a~~~l~~~~VG~l~~   82 (134)
                      .+++|++++++|++.++.|++|+| |||+|+|+.+||||+.+|..++|+|+|++|.+. |...  +.+.|+.+.+|...+
T Consensus         7 ~~~~~we~~~~~~~~~~~W~~id~-vYd~s~~~~~HPGG~~~I~~~~g~DaTdaF~Af-H~~~~~~~~~l~~l~~~~~~p   84 (430)
T KOG4232|consen    7 PTTFSWEGKRKHDKAEGLWLVIDG-VYDISDWIKRHPGGSRVIEHYAGQDATDAFEAF-HPGTAFAYKHLKPLLIGELSP   84 (430)
T ss_pred             ceeeeccchhhccCCCceEEEeec-cccHHHHHHhCCCchhHHHHhcCCccchHHHHh-CCChHHHHHHHHHHHcCCcCc
Confidence            458999999999999999999999 999999999999999999999999999999984 7665  778999999999876


Q ss_pred             CC
Q 032775           83 ST   84 (134)
Q Consensus        83 ~~   84 (134)
                      +.
T Consensus        85 e~   86 (430)
T KOG4232|consen   85 EI   86 (430)
T ss_pred             cc
Confidence            54


No 10 
>COG4892 Predicted heme/steroid binding protein [General function prediction only]
Probab=98.73  E-value=2.1e-08  Score=64.29  Aligned_cols=75  Identities=21%  Similarity=0.359  Sum_probs=55.5

Q ss_pred             CCcCHHHHhcccCCC-CeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCchhhhh-cCCCHHHHHhhhcCeeEEeCCC
Q 032775            6 KIHQFEEVATHNKTK-DCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDATNDFED-VGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus         6 ~~~t~~ev~~h~~~~-~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~-~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      +.||.+|+.+.|.++ ..+|.++|.||||+.-- ..-+|..--+.-+|+|+|++|++ ..|-.+..+-++.  ||.|..+
T Consensus         2 refTLEELs~ynG~nGpaYiA~~G~VYDvS~s~-~W~dGtHqglhsaG~DLs~~~~~~aphg~eil~~~Pv--VG~L~k~   78 (81)
T COG4892           2 REFTLEELSKYNGENGPAYIAVNGTVYDVSLSP-SWGDGTHQGLHSAGKDLSSEFNSCAPHGMEILTSLPV--VGALIKE   78 (81)
T ss_pred             ceecHHHHHhhcCCCCCeEEEECCEEEeeccCc-ccCCCccccccccchhHHHHHhhcCCchhHHHhcCch--hheeecc
Confidence            679999999988765 69999999999998632 12344444456689999999984 4566666665554  7887543


No 11 
>KOG1110 consensus Putative steroid membrane receptor Hpr6.6/25-Dx [General function prediction only]
Probab=97.84  E-value=0.00011  Score=55.08  Aligned_cols=55  Identities=31%  Similarity=0.375  Sum_probs=42.3

Q ss_pred             CCCCcCHHHHhcccCCC---CeEEEEcCEEEeccc-cCCCCCChHHHHHHhhCCCCchhhh
Q 032775            4 DPKIHQFEEVATHNKTK---DCWLIISGKVYDVSS-FMDDHPGGDEVLISATGKDATNDFE   60 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~---~~wvvi~g~VYDvt~-f~~~HPGG~~~l~~~aG~D~T~~f~   60 (134)
                      ..+.||.+||.+.+..+   ..++.|+|+|||||. -.-.-|||.-  -.+||+|++....
T Consensus        54 ~~~dfT~eEL~~ydGs~~d~~Il~AI~G~VYDVT~Gr~FYGp~GpY--~~fAG~DASR~La  112 (183)
T KOG1110|consen   54 KVRDFTVEELRQYDGSDPDKPILLAINGKVYDVTRGREFYGPGGPY--SLFAGKDASRGLA  112 (183)
T ss_pred             cccccCHHHHHhcCCCCCCCceEEEecceEEEecCCccccCCCCCc--hhhcccchHHHHH
Confidence            34589999999987765   488999999999985 2235788864  3468999998754


No 12 
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only]
Probab=96.67  E-value=0.00092  Score=52.16  Aligned_cols=56  Identities=32%  Similarity=0.381  Sum_probs=43.1

Q ss_pred             CCCCcCHHHHhcccCCC---CeEEEEcCEEEeccccC-CCCCChHHHHHHhhCCCCchhhhh
Q 032775            4 DPKIHQFEEVATHNKTK---DCWLIISGKVYDVSSFM-DDHPGGDEVLISATGKDATNDFED   61 (134)
Q Consensus         4 ~~~~~t~~ev~~h~~~~---~~wvvi~g~VYDvt~f~-~~HPGG~~~l~~~aG~D~T~~f~~   61 (134)
                      ....||++||+..|...   ..++.|-|.||||+.=. ..-||+  -...+||+|+|.+|-.
T Consensus        58 ~k~lFtpeeLa~fnGt~e~~piyLaiLGsVfdVs~gk~hYgsG~--sYnhFaGRDASrAFvs  117 (281)
T KOG1108|consen   58 DKILFTPEELAKFNGTEEGRPIYLAILGSVFDVSRGKKHYGSGC--SYNHFAGRDASRAFVS  117 (281)
T ss_pred             CceeeCHHHHhhccCCCCCCceeeeeeceeeeccCCeeeeCCCC--Ccccccccccchheec
Confidence            45689999999987654   38899999999998743 233443  4568899999999853


No 13 
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=90.39  E-value=0.16  Score=34.39  Aligned_cols=13  Identities=38%  Similarity=0.905  Sum_probs=11.6

Q ss_pred             EEcCEEEeccccC
Q 032775           25 IISGKVYDVSSFM   37 (134)
Q Consensus        25 vi~g~VYDvt~f~   37 (134)
                      ..+|+|||||+|+
T Consensus        60 c~~g~VyDiTeWA   72 (94)
T PF14901_consen   60 CMDGKVYDITEWA   72 (94)
T ss_pred             EcCceEEehhhhh
Confidence            4699999999997


No 14 
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=71.04  E-value=2.3  Score=36.43  Aligned_cols=15  Identities=33%  Similarity=0.849  Sum_probs=12.8

Q ss_pred             EEEEcCEEEeccccC
Q 032775           23 WLIISGKVYDVSSFM   37 (134)
Q Consensus        23 wvvi~g~VYDvt~f~   37 (134)
                      +++-||+|||+|+|+
T Consensus       380 y~c~DgkVYDITeWA  394 (490)
T KOG0720|consen  380 YACMDGKVYDITEWA  394 (490)
T ss_pred             eeecCCceEeehhhh
Confidence            346699999999998


No 15 
>PRK14758 hypothetical protein; Provisional
Probab=67.19  E-value=15  Score=19.04  Aligned_cols=22  Identities=27%  Similarity=0.446  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhc
Q 032775          111 ILQILVPLLILGLAFAVRHYTK  132 (134)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~  132 (134)
                      .+.++..++|+...+|.++|++
T Consensus         6 rFEliLivlIlCalia~~fy~s   27 (27)
T PRK14758          6 RFEFILIILILCALIAARFYLS   27 (27)
T ss_pred             HHHHHHHHHHHHHHHHHHhccC
Confidence            4556666677777788887753


No 16 
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=62.67  E-value=4.5  Score=33.29  Aligned_cols=38  Identities=16%  Similarity=0.376  Sum_probs=22.7

Q ss_pred             CCCChHHHHHHhhCC-CCchhhhhcCCCHHHHHhhhcCeeEEeCCC
Q 032775           39 DHPGGDEVLISATGK-DATNDFEDVGHSDSAREMMDKYYIGDIDPS   83 (134)
Q Consensus        39 ~HPGG~~~l~~~aG~-D~T~~f~~~~Hs~~a~~~l~~~~VG~l~~~   83 (134)
                      -||||.++|.++.+. .+++..-     ...+..|++  .|++...
T Consensus       276 ~HPGG~KVida~~~sLgls~e~l-----~~s~~~L~~--~GNMSSa  314 (356)
T COG3424         276 VHPGGPKVIDAYEESLGLSPEAL-----ELSWDVLRE--YGNMSSA  314 (356)
T ss_pred             eCCCCchHHHHHHHhcCCCHHHH-----HHHHHHHHH--hCCccch
Confidence            599999999988754 4443321     123455555  5665443


No 17 
>PRK00159 putative septation inhibitor protein; Reviewed
Probab=59.07  E-value=30  Score=23.08  Aligned_cols=19  Identities=32%  Similarity=0.742  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q 032775          114 ILVPLLILGLAFAVRHYTK  132 (134)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~  132 (134)
                      .++.+.++|++..+.||+.
T Consensus        36 ~m~glm~~GllWlvvyYl~   54 (87)
T PRK00159         36 LMLGLMLIGLAWLVVNYLA   54 (87)
T ss_pred             HHHHHHHHHHHHHHHHhhc
Confidence            4456668888888777765


No 18 
>PF06781 UPF0233:  Uncharacterised protein family (UPF0233);  InterPro: IPR009619 This is a group of proteins of unknown function.
Probab=58.78  E-value=26  Score=23.34  Aligned_cols=20  Identities=30%  Similarity=0.617  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHhhcC
Q 032775          114 ILVPLLILGLAFAVRHYTKK  133 (134)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~  133 (134)
                      .++.+.++|++-.+.||+..
T Consensus        36 ~m~~lmllGL~WiVvyYi~~   55 (87)
T PF06781_consen   36 LMLGLMLLGLLWIVVYYISG   55 (87)
T ss_pred             HHHHHHHHHHHHHhhhhccc
Confidence            44566688887777777653


No 19 
>PF11698 V-ATPase_H_C:  V-ATPase subunit H;  InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C-terminal domain of subunit H (also known as Vma13p) found in the V1 complex of V-ATPases. This subunit has a regulatory function, being responsible for activating ATPase activity and coupling ATPase activity to proton flow []. The yeast enzyme contains five motifs similar to the HEAT or Armadillo repeats seen in the importins, and can be divided into two distinct domains: a large N-terminal domain consisting of stacked alpha helices, and a smaller C-terminal alpha-helical domain with a similar superhelical topology to an armadillo repeat []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0000221 vacuolar proton-transporting V-type ATPase, V1 domain; PDB: 1HO8_A.
Probab=57.96  E-value=0.67  Score=32.68  Aligned_cols=27  Identities=19%  Similarity=0.429  Sum_probs=22.0

Q ss_pred             EEeccccCCCCCChHHHHHHhhCCCCc
Q 032775           30 VYDVSSFMDDHPGGDEVLISATGKDAT   56 (134)
Q Consensus        30 VYDvt~f~~~HPGG~~~l~~~aG~D~T   56 (134)
                      -+|+..|+..||.|..++....+|+.-
T Consensus        65 c~Dig~~vr~~p~gr~ii~~lg~K~~v   91 (119)
T PF11698_consen   65 CHDIGEFVRHYPNGRNIIEKLGAKERV   91 (119)
T ss_dssp             HHHHHHHHHH-GGGHHHHHHHSHHHHH
T ss_pred             hcchHHHHHHChhHHHHHHhcChHHHH
Confidence            379999999999999999888777543


No 20 
>PF02797 Chal_sti_synt_C:  Chalcone and stilbene synthases, C-terminal domain;  InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2.3.1.74 from EC) and stilbene synthases (STS) (formerly known as resveratrol synthases) are related plant enzymes. CHS is an important enzyme in flavanoid biosynthesis and STS is a key enzyme in stilbene-type phyloalexin biosynthesis. Both enzymes catalyze the addition of three molecules of malonyl-CoA to a starter CoA ester (a typical example is 4-coumaroyl-CoA), producing either a chalcone (with CHS) or stilbene (with STS) []. These enzymes have a conserved cysteine residue, located in the central section of the protein sequence, which is essential for the catalytic activity of both enzymes and probably represents the binding site for the 4-coumaryl-CoA group []. This domain of chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in the N-terminal domain. ; GO: 0016746 transferase activity, transferring acyl groups; PDB: 3OV2_A 3OV3_B 1Z1F_A 1Z1E_A 3ALE_C 3OIT_A 2H84_A 1TEE_D 1TED_A 2P0U_A ....
Probab=53.82  E-value=5  Score=29.15  Aligned_cols=15  Identities=33%  Similarity=0.625  Sum_probs=11.2

Q ss_pred             CCCCChHHHHHHhhC
Q 032775           38 DDHPGGDEVLISATG   52 (134)
Q Consensus        38 ~~HPGG~~~l~~~aG   52 (134)
                      .-||||.++|.....
T Consensus        64 avHPGG~~ILd~v~~   78 (151)
T PF02797_consen   64 AVHPGGRKILDAVEE   78 (151)
T ss_dssp             EEE-SSHHHHHHHHH
T ss_pred             eecCChHHHHHHHHH
Confidence            469999999987764


No 21 
>TIGR02148 Fibro_Slime fibro-slime domain. This model represents a conserved region of about 90 amino acids, shared in at least 4 distinct large putative proteins from the slime mold Dictyostelium discoideum and 10 proteins from the rumen bacterium Fibrobacter succinogenes, and in no other species so far. We propose here the name fibro-slime domain
Probab=50.49  E-value=18  Score=24.29  Aligned_cols=22  Identities=27%  Similarity=0.576  Sum_probs=16.8

Q ss_pred             cccCCCCeEEEEcCE-EEecccc
Q 032775           15 THNKTKDCWLIISGK-VYDVSSF   36 (134)
Q Consensus        15 ~h~~~~~~wvvi~g~-VYDvt~f   36 (134)
                      +-...+|.||-|+|+ |-|+-..
T Consensus        23 ~F~GDDDvWVFIn~kLv~DlGG~   45 (90)
T TIGR02148        23 EFRGDDDVWVFINNKLVVDIGGQ   45 (90)
T ss_pred             EEEcCCeEEEEECCEEEEEccCc
Confidence            345778999999998 6777654


No 22 
>PRK02251 putative septation inhibitor protein; Reviewed
Probab=48.84  E-value=53  Score=21.89  Aligned_cols=19  Identities=37%  Similarity=0.704  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q 032775          114 ILVPLLILGLAFAVRHYTK  132 (134)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~  132 (134)
                      .++.+.++|++..+.||+.
T Consensus        37 ~m~~lm~~Gl~WlvvyYl~   55 (87)
T PRK02251         37 LFVALMIIGLIWLVVYYLS   55 (87)
T ss_pred             HHHHHHHHHHHHHHHHhhh
Confidence            4456668888888888764


No 23 
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses  ATP to actively transport protons into organelles and extracellular compartments. The topology is that of a superhelical spiral, in part the geometry is similar to superhelices composed of armadillo repeat motifs, as found in importins for example.
Probab=48.23  E-value=4  Score=34.74  Aligned_cols=35  Identities=20%  Similarity=0.401  Sum_probs=28.7

Q ss_pred             CCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCCCc
Q 032775           20 KDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKDAT   56 (134)
Q Consensus        20 ~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T   56 (134)
                      +..++.|-  -+|+..|+..||.|..++....||+.-
T Consensus       367 d~~~laVA--c~Dige~vr~~P~gr~i~~~lg~K~~v  401 (429)
T cd00256         367 DPIILAVA--CHDIGEYVRHYPRGKDVVEQLGGKQRV  401 (429)
T ss_pred             Ccceeehh--hhhHHHHHHHCccHHHHHHHcCcHHHH
Confidence            45666665  489999999999999999998888653


No 24 
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=39.73  E-value=22  Score=25.31  Aligned_cols=14  Identities=36%  Similarity=0.435  Sum_probs=11.8

Q ss_pred             CeEEEEcCEEEecc
Q 032775           21 DCWLIISGKVYDVS   34 (134)
Q Consensus        21 ~~wvvi~g~VYDvt   34 (134)
                      .+-|.+||++|||+
T Consensus         4 ~~~itvng~~y~V~   17 (130)
T PRK06549          4 KFKITIDGKEYLVE   17 (130)
T ss_pred             eEEEEECCEEEEEE
Confidence            35688999999996


No 25 
>CHL00008 petG cytochrome b6/f complex subunit V
Probab=36.69  E-value=55  Score=18.24  Aligned_cols=17  Identities=29%  Similarity=0.665  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHH-Hhh
Q 032775          115 LVPLLILGLAFAVR-HYT  131 (134)
Q Consensus       115 ~~~~~~~~~~~~~~-~~~  131 (134)
                      +||+.++|+.++.| .|-
T Consensus        13 lipvTl~GlfvaAylQYr   30 (37)
T CHL00008         13 LIPITLAGLFVTAYLQYR   30 (37)
T ss_pred             hHHHHHHHHHHHHHHHHh
Confidence            47888888877766 443


No 26 
>PRK00665 petG cytochrome b6-f complex subunit PetG; Reviewed
Probab=36.08  E-value=58  Score=18.16  Aligned_cols=16  Identities=38%  Similarity=0.731  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHH-Hh
Q 032775          115 LVPLLILGLAFAVR-HY  130 (134)
Q Consensus       115 ~~~~~~~~~~~~~~-~~  130 (134)
                      +||+.++|+.++.| .|
T Consensus        13 lipiTl~GlfvaAylQY   29 (37)
T PRK00665         13 LIPVTLAGLFVAAWNQY   29 (37)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            47888888877766 44


No 27 
>PHA02131 hypothetical protein
Probab=36.06  E-value=31  Score=21.29  Aligned_cols=15  Identities=27%  Similarity=0.913  Sum_probs=12.4

Q ss_pred             CeEEEE-cCEEEeccc
Q 032775           21 DCWLII-SGKVYDVSS   35 (134)
Q Consensus        21 ~~wvvi-~g~VYDvt~   35 (134)
                      .||+.+ +|+|-|+|=
T Consensus        30 ~c~imfk~~~v~dctf   45 (70)
T PHA02131         30 SCWIMFKNDQVIDCTF   45 (70)
T ss_pred             EEEEEEcCCCEEEeee
Confidence            599987 789999873


No 28 
>PHA02844 putative transmembrane protein; Provisional
Probab=33.02  E-value=84  Score=20.34  Aligned_cols=10  Identities=0%  Similarity=0.135  Sum_probs=4.4

Q ss_pred             HHHHHHHHHH
Q 032775          110 KILQILVPLL  119 (134)
Q Consensus       110 ~~~~~~~~~~  119 (134)
                      .|..|++.++
T Consensus        47 ~~~~~ii~i~   56 (75)
T PHA02844         47 STKIWILTII   56 (75)
T ss_pred             hHHHHHHHHH
Confidence            3444444444


No 29 
>PHA02975 hypothetical protein; Provisional
Probab=32.68  E-value=81  Score=20.09  Aligned_cols=9  Identities=0%  Similarity=0.357  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 032775          111 ILQILVPLL  119 (134)
Q Consensus       111 ~~~~~~~~~  119 (134)
                      |..+++.++
T Consensus        44 ~~~~ii~i~   52 (69)
T PHA02975         44 SIILIIFII   52 (69)
T ss_pred             HHHHHHHHH
Confidence            343444433


No 30 
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=32.59  E-value=53  Score=23.33  Aligned_cols=20  Identities=40%  Similarity=0.605  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 032775          109 IKILQILVPLLILGLAFAVR  128 (134)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~  128 (134)
                      .+|.-|+.|+++++++.++.
T Consensus       100 ~t~~LW~~P~lll~~G~~~~  119 (126)
T TIGR03147       100 QTLLLWLLPVLLLLLAFVLL  119 (126)
T ss_pred             chHHHHHHHHHHHHHHHHHH
Confidence            35778999998766554433


No 31 
>PF05521 Phage_H_T_join:  Phage head-tail joining protein ;  InterPro: IPR008767  This entry describes the head-tail adaptor protein of bacteriophage SPP1 and related proteins in other bacteriophage and prophage regions of bacterial genomes. Homologues are also found in Gene Transfer Agents (GTA) [], including ORFg7 (RCAP_rcc01689) of the GTA of Rhodobacter capsulatus (Rhodopseudomonas capsulata) [see Fig.1, in ].; PDB: 2KCA_A 2KZ4_A.
Probab=32.14  E-value=53  Score=20.46  Aligned_cols=18  Identities=33%  Similarity=0.532  Sum_probs=12.7

Q ss_pred             CCeEEEEcCEEEeccccC
Q 032775           20 KDCWLIISGKVYDVSSFM   37 (134)
Q Consensus        20 ~~~wvvi~g~VYDvt~f~   37 (134)
                      .+..|.++|++|+|....
T Consensus        65 ~~~ri~~~g~~y~I~~i~   82 (95)
T PF05521_consen   65 PDMRIKYDGKVYNIKSID   82 (95)
T ss_dssp             TTEEEEECTEEEEE-S--
T ss_pred             cceEEEECCEEEEEEEEC
Confidence            356788999999998843


No 32 
>PF11044 TMEMspv1-c74-12:  Plectrovirus spv1-c74 ORF 12 transmembrane protein;  InterPro: IPR022743  This is a group of proteins expressed by Plectroviruses. The Plectroviruses are single-stranded DNA viruses belonging to the Inoviridae. This entry represents putative transmembrane proteins of unknown function. 
Probab=32.08  E-value=82  Score=18.46  Aligned_cols=19  Identities=21%  Similarity=0.181  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 032775          110 KILQILVPLLILGLAFAVR  128 (134)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~  128 (134)
                      .|..+++.++|+...|++.
T Consensus         3 ~wlt~iFsvvIil~If~~i   21 (49)
T PF11044_consen    3 TWLTTIFSVVIILGIFAWI   21 (49)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            3666777777555555544


No 33 
>PHA02819 hypothetical protein; Provisional
Probab=32.03  E-value=90  Score=20.00  Aligned_cols=10  Identities=10%  Similarity=0.225  Sum_probs=4.4

Q ss_pred             HHHHHHHHHH
Q 032775          110 KILQILVPLL  119 (134)
Q Consensus       110 ~~~~~~~~~~  119 (134)
                      .|..+++.++
T Consensus        45 ~~~~~ii~l~   54 (71)
T PHA02819         45 LRYYLIIGLV   54 (71)
T ss_pred             hHHHHHHHHH
Confidence            3444444444


No 34 
>PF04375 HemX:  HemX;  InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2.1.1.107 from EC) []; however, there is no direct evidence to support this annotation for these proteins, which come from mainly pathogenic Gram-negative organisms. There is some evidence to suggest that the proteins are membrane anchored as they have a predicted N-terminal signal peptide and transmembrane domain and may be involved in haem transport []. 
Probab=31.77  E-value=1.4e+02  Score=24.72  Aligned_cols=11  Identities=18%  Similarity=0.105  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHh
Q 032775          120 ILGLAFAVRHY  130 (134)
Q Consensus       120 ~~~~~~~~~~~  130 (134)
                      +++++.+++||
T Consensus        40 ~~alg~~~~~~   50 (372)
T PF04375_consen   40 ALALGAGGWYW   50 (372)
T ss_pred             HHHHHHHHHHH
Confidence            34555556655


No 35 
>PHA02650 hypothetical protein; Provisional
Probab=31.48  E-value=85  Score=20.59  Aligned_cols=10  Identities=0%  Similarity=0.062  Sum_probs=4.1

Q ss_pred             HHHHHHHHHH
Q 032775          110 KILQILVPLL  119 (134)
Q Consensus       110 ~~~~~~~~~~  119 (134)
                      .|..+++.++
T Consensus        48 ~~~~~ii~i~   57 (81)
T PHA02650         48 NGQNFIFLIF   57 (81)
T ss_pred             hHHHHHHHHH
Confidence            3444444443


No 36 
>PF12669 P12:  Virus attachment protein p12 family
Probab=31.08  E-value=35  Score=20.77  Aligned_cols=17  Identities=29%  Similarity=0.843  Sum_probs=7.0

Q ss_pred             HHHHHHHH-HHH-HHHHhh
Q 032775          115 LVPLLILG-LAF-AVRHYT  131 (134)
Q Consensus       115 ~~~~~~~~-~~~-~~~~~~  131 (134)
                      +|.+++++ ++| +++++.
T Consensus         3 II~~Ii~~~~~~v~~r~~~   21 (58)
T PF12669_consen    3 IIGIIILAAVAYVAIRKFI   21 (58)
T ss_pred             eHHHHHHHHHHHHHHHHHH
Confidence            34444333 333 335444


No 37 
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion]
Probab=28.69  E-value=15  Score=31.35  Aligned_cols=33  Identities=21%  Similarity=0.410  Sum_probs=28.0

Q ss_pred             CCeEEEEcCEEEeccccCCCCCChHHHHHHhhCCC
Q 032775           20 KDCWLIISGKVYDVSSFMDDHPGGDEVLISATGKD   54 (134)
Q Consensus        20 ~~~wvvi~g~VYDvt~f~~~HPGG~~~l~~~aG~D   54 (134)
                      +..|+++-  -.|++.|+..||-|..++.++.||.
T Consensus       380 Dp~iL~VA--c~DIge~Vr~yP~gk~vv~k~ggKe  412 (442)
T KOG2759|consen  380 DPIILCVA--CHDIGEYVRHYPEGKAVVEKYGGKE  412 (442)
T ss_pred             CCceeehh--hhhHHHHHHhCchHhHHHHHhchHH
Confidence            45677665  3799999999999999999999983


No 38 
>PF02529 PetG:  Cytochrome B6-F complex subunit 5;  InterPro: IPR003683 This family consists of cytochrome b6/f complex subunit 5 (PetG). The cytochrome bf complex, found in green plants, eukaryotic algae and cyanobacteria, connects photosystem I to photosystem II in the electron transport chain, functioning as a plastoquinol:plastocyanin/cytochrome c6 oxidoreductase []. The purified complex from the unicellular alga Chlamydomonas reinhardtii contains seven subunits; namely four high molecular weight subunits (cytochrome f, Rieske iron-sulphur protein, cytochrome b6, and subunit IV) and three approximately miniproteins (PetG, PetL, and PetX) []. Stoichiometry measurements are consistent with every subunit being present as two copies per b6/f dimer. The absence of PetG affects either the assembly or stability of the cytochrome bf complex in C. reinhardtii [].; GO: 0009512 cytochrome b6f complex; PDB: 1Q90_G 2ZT9_G 1VF5_G 2D2C_G 2E74_G 2E75_G 2E76_G.
Probab=28.68  E-value=86  Score=17.52  Aligned_cols=18  Identities=33%  Similarity=0.693  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHH-Hhhc
Q 032775          115 LVPLLILGLAFAVR-HYTK  132 (134)
Q Consensus       115 ~~~~~~~~~~~~~~-~~~~  132 (134)
                      ++|+.++|+.++.| .|.+
T Consensus        13 li~vtl~Glfv~Ay~QY~R   31 (37)
T PF02529_consen   13 LIPVTLAGLFVAAYLQYRR   31 (37)
T ss_dssp             HHHHHHHHHHHHHHHHHCS
T ss_pred             hHHHHHHHHHHHHHHHHhc
Confidence            46777788766655 5543


No 39 
>PHA03054 IMV membrane protein; Provisional
Probab=27.83  E-value=91  Score=19.99  Aligned_cols=10  Identities=0%  Similarity=0.152  Sum_probs=4.4

Q ss_pred             HHHHHHHHHH
Q 032775          110 KILQILVPLL  119 (134)
Q Consensus       110 ~~~~~~~~~~  119 (134)
                      .|..+++.++
T Consensus        47 ~~~~~ii~l~   56 (72)
T PHA03054         47 GWYWLIIIFF   56 (72)
T ss_pred             hHHHHHHHHH
Confidence            3444444444


No 40 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=27.18  E-value=85  Score=21.08  Aligned_cols=11  Identities=27%  Similarity=0.546  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHh
Q 032775          120 ILGLAFAVRHY  130 (134)
Q Consensus       120 ~~~~~~~~~~~  130 (134)
                      ++++.++++|+
T Consensus        74 IlVily~IyYF   84 (101)
T PF06024_consen   74 ILVILYAIYYF   84 (101)
T ss_pred             HHHHHhhheEE
Confidence            44455555544


No 41 
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=27.09  E-value=20  Score=26.00  Aligned_cols=21  Identities=33%  Similarity=0.214  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 032775          108 IIKILQILVPLLILGLAFAVR  128 (134)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~  128 (134)
                      +.+|.-|+.|++++++++++.
T Consensus        99 ~~~~~lW~~P~~~l~~g~~~~  119 (148)
T PF03918_consen   99 GFTWLLWLGPFLLLLLGGALL  119 (148)
T ss_dssp             ---------------------
T ss_pred             ccHHHHHHHHHHHHHHHHHHH
Confidence            346778999999777655544


No 42 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=25.64  E-value=82  Score=19.41  Aligned_cols=15  Identities=40%  Similarity=0.476  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHH
Q 032775          114 ILVPLLILGLAFAVR  128 (134)
Q Consensus       114 ~~~~~~~~~~~~~~~  128 (134)
                      +++|+.++.+++++.
T Consensus         6 ~Lipvsi~l~~v~l~   20 (58)
T COG3197           6 ILIPVSILLGAVGLG   20 (58)
T ss_pred             eHHHHHHHHHHHHHH
Confidence            567888666655544


No 43 
>PF11093 Mitochondr_Som1:  Mitochondrial export protein Som1;  InterPro: IPR024645 Som1 is a component of the mitochondrial protein export system. Som1 proteins exhibit a highly conserved region and a pattern of cysteine residues []. Stabilisation of Som1 occurs through an interaction between Som1 and Imp1, a peptidase required for proteolytic processing of certain proteins during their transport across the mitochondrial membrane []. This suggests that Som1 represents a third subunit of the Imp1 peptidase complex [].; GO: 0042720 mitochondrial inner membrane peptidase complex
Probab=24.81  E-value=40  Score=22.18  Aligned_cols=16  Identities=19%  Similarity=0.303  Sum_probs=14.8

Q ss_pred             CCCCCCCcCHHHHhcc
Q 032775            1 MASDPKIHQFEEVATH   16 (134)
Q Consensus         1 m~~~~~~~t~~ev~~h   16 (134)
                      |++..++|+.+|+..|
T Consensus         1 MAPP~pV~~~~el~~~   16 (83)
T PF11093_consen    1 MAPPTPVFSRSELPSQ   16 (83)
T ss_pred             CCCCcceEcHHHhHHH
Confidence            8999999999999976


No 44 
>COG4858 Uncharacterized membrane-bound protein conserved in bacteria [Function unknown]
Probab=24.41  E-value=64  Score=24.84  Aligned_cols=18  Identities=44%  Similarity=0.818  Sum_probs=12.3

Q ss_pred             HHHHHHH-HHHHHHHhhcC
Q 032775          116 VPLLILG-LAFAVRHYTKK  133 (134)
Q Consensus       116 ~~~~~~~-~~~~~~~~~~~  133 (134)
                      ++++|.| +++|+|||+++
T Consensus       196 i~l~IiGav~lalRfylkk  214 (226)
T COG4858         196 IALTIIGAVILALRFYLKK  214 (226)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3444555 68899998875


No 45 
>PF10618 Tail_tube:  Phage tail tube protein;  InterPro: IPR019596  This entry is represented by Bacteriophage Mu, GpM tail tube protein. Bacteriophage Mu has an eicosahedral head and contractile tail. The tail is composed of an outer sheath and an inner tube. 
Probab=23.95  E-value=61  Score=22.54  Aligned_cols=25  Identities=20%  Similarity=0.371  Sum_probs=21.6

Q ss_pred             CCeEEEEcCEEEeccccCCCCCChH
Q 032775           20 KDCWLIISGKVYDVSSFMDDHPGGD   44 (134)
Q Consensus        20 ~~~wvvi~g~VYDvt~f~~~HPGG~   44 (134)
                      +.|+|.|+|+-|++.+=....|||.
T Consensus         7 G~a~i~vdG~~l~~~~g~~~~~gg~   31 (119)
T PF10618_consen    7 GTAYIRVDGQQLPVKGGATYNPGGV   31 (119)
T ss_pred             EEEEEEECCEEEEccCCeEECCCCe
Confidence            5689999999999997788888874


No 46 
>PF13260 DUF4051:  Protein of unknown function (DUF4051)
Probab=22.88  E-value=1.5e+02  Score=17.61  Aligned_cols=14  Identities=7%  Similarity=0.325  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHHHHH
Q 032775          111 ILQILVPLLILGLAF  125 (134)
Q Consensus       111 ~~~~~~~~~~~~~~~  125 (134)
                      |+ |+|.++++++.|
T Consensus         5 wy-wivli~lv~~gy   18 (54)
T PF13260_consen    5 WY-WIVLIVLVVVGY   18 (54)
T ss_pred             HH-HHHHHHHHHHHH
Confidence            44 566555544433


No 47 
>PF04415 DUF515:  Protein of unknown function (DUF515)    ;  InterPro: IPR007509 This is a family of hypothetical archaeal proteins.
Probab=22.31  E-value=1.8e+02  Score=24.82  Aligned_cols=20  Identities=5%  Similarity=0.323  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q 032775          113 QILVPLLILGLAFAVRHYTK  132 (134)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~  132 (134)
                      ..++.+++++++|+.|+++.
T Consensus        36 a~Vl~iIii~~~~~~Y~~~~   55 (416)
T PF04415_consen   36 AAVLIIIIIFIVYNIYYFLQ   55 (416)
T ss_pred             hhhHhHHHHHHHHHHHHHhh
Confidence            33455556667777776654


No 48 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=22.10  E-value=2.1e+02  Score=18.49  Aligned_cols=22  Identities=32%  Similarity=0.692  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 032775          107 FIIKILQILVPLLILGLAFAVR  128 (134)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~  128 (134)
                      +..+.+.++.|++++.+.+++.
T Consensus        22 Fl~~vll~LtPlfiisa~lSwk   43 (74)
T PF15086_consen   22 FLTTVLLILTPLFIISAVLSWK   43 (74)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHH
Confidence            4556666778888877766554


No 49 
>PRK10144 formate-dependent nitrite reductase complex subunit NrfF; Provisional
Probab=21.22  E-value=1.1e+02  Score=21.72  Aligned_cols=15  Identities=20%  Similarity=0.392  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHHH
Q 032775          109 IKILQILVPLLILGL  123 (134)
Q Consensus       109 ~~~~~~~~~~~~~~~  123 (134)
                      .+|.-|+.|++++++
T Consensus       100 ~t~~LW~~P~~lll~  114 (126)
T PRK10144        100 QTLVLWALPVVLLLL  114 (126)
T ss_pred             chHHHHHHHHHHHHH
Confidence            357889999885554


No 50 
>PF13633 N_methyl_3:  Prokaryotic N-terminal methylation site
Probab=20.74  E-value=1.3e+02  Score=14.87  Aligned_cols=16  Identities=25%  Similarity=0.669  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q 032775          111 ILQILVPLLILGLAFA  126 (134)
Q Consensus       111 ~~~~~~~~~~~~~~~~  126 (134)
                      ++..++.++++++..+
T Consensus         3 LIEvlIa~~i~~i~~~   18 (22)
T PF13633_consen    3 LIEVLIAIAILGILAL   18 (22)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4566677776665443


No 51 
>PF15018 InaF-motif:  TRP-interacting helix
Probab=20.54  E-value=1.8e+02  Score=16.35  Aligned_cols=21  Identities=5%  Similarity=0.236  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHh
Q 032775          110 KILQILVPLLILGLAFAVRHY  130 (134)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~  130 (134)
                      ....++..+.++|+.++++|.
T Consensus         9 tV~~Yl~~VSl~Ai~LsiYY~   29 (38)
T PF15018_consen    9 TVVAYLFSVSLAAIVLSIYYI   29 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            344455555566666666654


Done!