Citrus Sinensis ID: 032789


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MATTGNKNINAKLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNQASFERAKKWVQELQAQGIHIQSLLQRFFSCINIFLGFM
cccccccEEEEEEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEEcccEEEEEEEEcccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEEcccc
********INAKLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNQASFERAKKWVQELQAQGIHIQSLLQRFFSCINIFLGFM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATTGNKNINAKLVLLGDVGAGKSSLVLRFVKGQFIEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITNQASFERAKKWVQELQAQGIHIQSLLQRFFSCINIFLGFM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABF2a Involved in the trafficking of soluble cargo proteins from the prevacuolar compartment to the central vacuole.probableP31582
Ras-related protein Rab-5A Required for the fusion of plasma membranes and early endosomes.probableQ86JP3
Ras-related protein Rab-5A Required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension.probableQ0IIG7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EFE, chain B
Confidence level:very confident
Coverage over the Query: 8-123
View the alignment between query and template
View the model in PyMOL