BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032792
(133 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1ZSO|A Chain A, Hypothetical Protein From Plasmodium Falciparum
pdb|1ZSO|B Chain B, Hypothetical Protein From Plasmodium Falciparum
Length = 164
Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust.
Identities = 26/113 (23%), Positives = 47/113 (41%), Gaps = 6/113 (5%)
Query: 3 NCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCGCGELSQKETCVSLAETLPTQGGKG 62
N ++ I A+LEN+ L CDD + + F ++ L++ + L +G
Sbjct: 11 NTVVRIKAELENVKRL----FCDDE-YLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRG 65
Query: 63 TTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDF 115
T N K + T+ + + + E + + F+CRG E +DF
Sbjct: 66 TANFXIKWTEYPKYSTINFVNTKN-SCSYEEVNNNEWRDFASFECRGIELIDF 117
>pdb|3ESG|A Chain A, Crystal Structure Of Hutd From Pseudomonas Fluorescens
Sbw25
pdb|3ESG|B Chain B, Crystal Structure Of Hutd From Pseudomonas Fluorescens
Sbw25
Length = 193
Score = 27.3 bits (59), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 20/43 (46%)
Query: 71 KFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPV 113
F G + +T+I G G LT + + G PL F RG V
Sbjct: 62 SFAGYQRVITVIQGAGMVLTVDGEEQRGLLPLQPFAFRGDSQV 104
>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
Length = 2060
Score = 26.6 bits (57), Expect = 4.7, Method: Composition-based stats.
Identities = 9/19 (47%), Positives = 12/19 (63%)
Query: 110 YEPVDFVFGVGWKVESSPI 128
+ P+DF VGWK + PI
Sbjct: 1325 FAPMDFAIVVGWKAITKPI 1343
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.140 0.443
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,104,291
Number of Sequences: 62578
Number of extensions: 163168
Number of successful extensions: 283
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 281
Number of HSP's gapped (non-prelim): 4
length of query: 133
length of database: 14,973,337
effective HSP length: 88
effective length of query: 45
effective length of database: 9,466,473
effective search space: 425991285
effective search space used: 425991285
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)