BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032792
         (133 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZSO|A Chain A, Hypothetical Protein From Plasmodium Falciparum
 pdb|1ZSO|B Chain B, Hypothetical Protein From Plasmodium Falciparum
          Length = 164

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 47/113 (41%), Gaps = 6/113 (5%)

Query: 3   NCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCGCGELSQKETCVSLAETLPTQGGKG 62
           N ++ I A+LEN+  L     CDD  + + F ++     L++        + L     +G
Sbjct: 11  NTVVRIKAELENVKRL----FCDDE-YLWIFNIRDSTSSLTRDNIQFRKTDILEIPNSRG 65

Query: 63  TTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDF 115
           T N   K     +  T+  +  +    + E   +  +     F+CRG E +DF
Sbjct: 66  TANFXIKWTEYPKYSTINFVNTKN-SCSYEEVNNNEWRDFASFECRGIELIDF 117


>pdb|3ESG|A Chain A, Crystal Structure Of Hutd From Pseudomonas Fluorescens
           Sbw25
 pdb|3ESG|B Chain B, Crystal Structure Of Hutd From Pseudomonas Fluorescens
           Sbw25
          Length = 193

 Score = 27.3 bits (59), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%)

Query: 71  KFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPV 113
            F G +  +T+I G G  LT +  +  G  PL  F  RG   V
Sbjct: 62  SFAGYQRVITVIQGAGMVLTVDGEEQRGLLPLQPFAFRGDSQV 104


>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
          Length = 2060

 Score = 26.6 bits (57), Expect = 4.7,   Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 12/19 (63%)

Query: 110  YEPVDFVFGVGWKVESSPI 128
            + P+DF   VGWK  + PI
Sbjct: 1325 FAPMDFAIVVGWKAITKPI 1343


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.140    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,104,291
Number of Sequences: 62578
Number of extensions: 163168
Number of successful extensions: 283
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 281
Number of HSP's gapped (non-prelim): 4
length of query: 133
length of database: 14,973,337
effective HSP length: 88
effective length of query: 45
effective length of database: 9,466,473
effective search space: 425991285
effective search space used: 425991285
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)