Citrus Sinensis ID: 032794

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKVCF
cccccccccHHHcHHHHHHHHHHHHHHHcccccccCECccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEEEccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHccccccccc
*********************KELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTV**CF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKVCF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ubiquitin-conjugating enzyme E2 18 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.probableQ9FMM0
Probable ubiquitin-conjugating enzyme E2 W Catalyzes the covalent attachment of ubiquitin to other proteins.probableQ55EY8
Probable ubiquitin-conjugating enzyme E2 W-A Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in degradation of misfolded chaperone substrate and DNA repair.probableQ4VBH4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z2U, chain A
Confidence level:very confident
Coverage over the Query: 14-131
View the alignment between query and template
View the model in PyMOL