BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032836
         (132 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WUU|A Chain A, Crystal Structure Of Human Galactokinase Complexed With
           Mgamppnp And Galactose
 pdb|1WUU|B Chain B, Crystal Structure Of Human Galactokinase Complexed With
           Mgamppnp And Galactose
 pdb|1WUU|C Chain C, Crystal Structure Of Human Galactokinase Complexed With
           Mgamppnp And Galactose
 pdb|1WUU|D Chain D, Crystal Structure Of Human Galactokinase Complexed With
           Mgamppnp And Galactose
          Length = 399

 Score = 29.3 bits (64), Expect = 0.65,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 33  SSVLLGGGIKLHDS---STISKKAQLSPLSFSASFRNHICRAAEYKF 76
           SSV LGGG+    S   +T +   QL P S + + R  +C+ AE+ F
Sbjct: 138 SSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSF 184


>pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle
 pdb|1G0U|T Chain T, A Gated Channel Into The Proteasome Core Particle
 pdb|3MG6|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           6
 pdb|3MG6|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           6
 pdb|3MG7|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           8
 pdb|3MG7|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           8
 pdb|3MG8|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           16
 pdb|3MG8|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           16
          Length = 248

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (56%)

Query: 74  YKFPDPIPEFADSETQKFRTHLL 96
           YK P PIP FAD   Q  + H L
Sbjct: 103 YKTPIPIPAFADRLGQYVQAHTL 125


>pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1FNT|U Chain U, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2ZCY|F Chain F, Yeast 20s Proteasome:syringolin A-Complex
 pdb|2ZCY|T Chain T, Yeast 20s Proteasome:syringolin A-Complex
 pdb|3BDM|F Chain F, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3BDM|T Chain T, Yeast 20s Proteasome:glidobactin A-Complex
          Length = 287

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (56%)

Query: 74  YKFPDPIPEFADSETQKFRTHLL 96
           YK P PIP FAD   Q  + H L
Sbjct: 102 YKTPIPIPAFADRLGQYVQAHTL 124


>pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1Z7Q|U Chain U, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|3NZJ|F Chain F, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Ligand 2a
 pdb|3NZJ|T Chain T, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Ligand 2a
 pdb|3NZW|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With 2b
 pdb|3NZW|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With 2b
 pdb|3NZX|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Ligand 2c
 pdb|3NZX|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Ligand 2c
 pdb|3UN4|F Chain F, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN4|T Chain T, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN8|F Chain F, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3UN8|T Chain T, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|4B4T|G Chain G, Near-Atomic Resolution Structural Model Of The Yeast 26s
           Proteasome
 pdb|4G4S|G Chain G, Structure Of Proteasome-Pba1-Pba2 Complex
 pdb|4INR|F Chain F, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu102
 pdb|4INR|T Chain T, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu102
 pdb|4INT|F Chain F, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu122
 pdb|4INT|T Chain T, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu122
 pdb|4INU|F Chain F, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu112
 pdb|4INU|T Chain T, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu112
          Length = 288

 Score = 27.7 bits (60), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (56%)

Query: 74  YKFPDPIPEFADSETQKFRTHLL 96
           YK P PIP FAD   Q  + H L
Sbjct: 103 YKTPIPIPAFADRLGQYVQAHTL 125


>pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4
           Angstroms Resolution
 pdb|1RYP|U Chain U, Crystal Structure Of The 20s Proteasome From Yeast At 2.4
           Angstroms Resolution
 pdb|1G65|F Chain F, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
           Molecular Basis For Selectivity Of
           Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G65|T Chain T, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
           Molecular Basis For Selectivity Of
           Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1JD2|F Chain F, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
           Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1JD2|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
           Complex: A Non- Covalent Proteasome Inhibitor
 pdb|2F16|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Bortezomib
 pdb|2F16|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Bortezomib
 pdb|2FAK|F Chain F, Crystal Structure Of Salinosporamide A In Complex With The
           Yeast 20s Proteasome
 pdb|2FAK|T Chain T, Crystal Structure Of Salinosporamide A In Complex With The
           Yeast 20s Proteasome
 pdb|2GPL|F Chain F, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
           Proteasome Inhibitors
 pdb|2GPL|T Chain T, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
           Proteasome Inhibitors
 pdb|3D29|F Chain F, Proteasome Inhibition By Fellutamide B
 pdb|3D29|T Chain T, Proteasome Inhibition By Fellutamide B
 pdb|3E47|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Homobelactosin C
 pdb|3E47|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Homobelactosin C
 pdb|3DY3|F Chain F, Crystal Structure Of Yeast 20s Proteasome In Complex With
           The Epimer Form Of Spirolactacystin
 pdb|3DY3|T Chain T, Crystal Structure Of Yeast 20s Proteasome In Complex With
           The Epimer Form Of Spirolactacystin
 pdb|3DY4|F Chain F, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Spirolactacystin
 pdb|3DY4|T Chain T, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Spirolactacystin
 pdb|3GPJ|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Syringolin B
 pdb|3GPJ|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Syringolin B
 pdb|3GPT|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPT|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPW|F Chain F, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Irreversible Inhibitor
           Ligand
 pdb|3GPW|T Chain T, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Irreversible Inhibitor
           Ligand
 pdb|3HYE|F Chain F, Crystal Structure Of 20s Proteasome In Complex With
           Hydroxylated Salinosporamide
 pdb|3HYE|T Chain T, Crystal Structure Of 20s Proteasome In Complex With
           Hydroxylated Salinosporamide
 pdb|1VSY|G Chain G, Proteasome Activator Complex
 pdb|1VSY|U Chain U, Proteasome Activator Complex
 pdb|3L5Q|L Chain L, Proteasome Activator Complex
 pdb|3L5Q|X Chain X, Proteasome Activator Complex
 pdb|3MG4|F Chain F, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG4|T Chain T, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG0|F Chain F, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG0|T Chain T, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3OKJ|F Chain F, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel Lead
           Structure Motif For Proteasome Inhibition
 pdb|3OKJ|T Chain T, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel Lead
           Structure Motif For Proteasome Inhibition
 pdb|3TDD|F Chain F, Crystal Structure Of Yeast Cp In Complex With Belactosin C
 pdb|3TDD|T Chain T, Crystal Structure Of Yeast Cp In Complex With Belactosin C
 pdb|3SHJ|F Chain F, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SHJ|T Chain T, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|4GK7|F Chain F, Yeast 20s Proteasome In Complex With The
           Syringolin-Glidobactin Chimera
 pdb|4GK7|T Chain T, Yeast 20s Proteasome In Complex With The
           Syringolin-Glidobactin Chimera
 pdb|4FZC|F Chain F, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZC|T Chain T, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZG|F Chain F, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4FZG|T Chain T, 20s Yeast Proteasome In Complex With Glidobactin
          Length = 244

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (56%)

Query: 74  YKFPDPIPEFADSETQKFRTHLL 96
           YK P PIP FAD   Q  + H L
Sbjct: 99  YKTPIPIPAFADRLGQYVQAHTL 121


>pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           24
 pdb|3OEU|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           24
 pdb|3OEV|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           25
 pdb|3OEV|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           25
 pdb|3SDI|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           20
 pdb|3SDI|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           20
 pdb|3SDK|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           34
 pdb|3SDK|T Chain T, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           34
          Length = 242

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 13/23 (56%)

Query: 74  YKFPDPIPEFADSETQKFRTHLL 96
           YK P PIP FAD   Q  + H L
Sbjct: 97  YKTPIPIPAFADRLGQYVQAHTL 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.135    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,400,065
Number of Sequences: 62578
Number of extensions: 116421
Number of successful extensions: 326
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 319
Number of HSP's gapped (non-prelim): 9
length of query: 132
length of database: 14,973,337
effective HSP length: 88
effective length of query: 44
effective length of database: 9,466,473
effective search space: 416524812
effective search space used: 416524812
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 46 (22.3 bits)