Query         032843
Match_columns 132
No_of_seqs    109 out of 193
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 06:36:56 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032843.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032843hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00186 ribosomal protein S26 100.0 8.1E-64 1.8E-68  370.6   8.0  106    1-106     1-106 (109)
  2 PF01283 Ribosomal_S26e:  Ribos 100.0 2.4E-64 5.2E-69  375.1   4.8  110    1-110     1-110 (113)
  3 PTZ00172 40S ribosomal protein 100.0 2.5E-63 5.5E-68  367.5   8.2  104    1-104     1-104 (108)
  4 PRK09335 30S ribosomal protein 100.0 2.3E-57   5E-62  329.6   6.8   94    1-98      1-94  (95)
  5 KOG1768 40s ribosomal protein  100.0 4.4E-55 9.6E-60  326.3   4.1  109    1-109     1-109 (115)
  6 COG4830 RPS26B Ribosomal prote 100.0 8.2E-52 1.8E-56  305.0   5.8   97    1-97      1-97  (108)
  7 COG1400 SEC65 Signal recogniti  73.1    0.78 1.7E-05   33.6  -0.8   26   27-54     20-45  (93)
  8 PF08209 Sgf11:  Sgf11 (transcr  56.9     7.2 0.00016   23.6   1.3   15   18-32      2-16  (33)
  9 PF07503 zf-HYPF:  HypF finger;  56.7     4.6  0.0001   24.6   0.5   14   15-28     16-29  (35)
 10 PF02591 DUF164:  Putative zinc  54.1     6.7 0.00015   25.0   0.9   13   18-30     44-56  (56)
 11 TIGR01031 rpmF_bact ribosomal   46.4      15 0.00032   24.2   1.7   28    2-29      2-35  (55)
 12 PRK04016 DNA-directed RNA poly  44.2      11 0.00023   26.0   0.8   14   19-32      3-16  (62)
 13 PF09889 DUF2116:  Uncharacteri  43.7     9.2  0.0002   25.8   0.4   17   21-37      4-20  (59)
 14 PF04726 Microvir_J:  Microviru  43.2      13 0.00029   21.4   0.9   15    1-15      1-15  (24)
 15 COG1644 RPB10 DNA-directed RNA  43.2      11 0.00023   26.2   0.6   13   19-31      3-15  (63)
 16 COG4481 Uncharacterized protei  42.8      14  0.0003   25.4   1.1   13   18-30     32-44  (60)
 17 KOG2612 Predicted integral mem  41.7     8.9 0.00019   28.7   0.1   15   17-31     71-85  (103)
 18 PF13119 DUF3973:  Domain of un  39.8      14 0.00029   23.8   0.7   11   71-81      1-12  (41)
 19 COG5112 UFD2 U1-like Zn-finger  38.7      11 0.00024   29.1   0.1   31   49-81     31-65  (126)
 20 PF10122 Mu-like_Com:  Mu-like   38.1      15 0.00032   24.6   0.7   18   19-36      3-20  (51)
 21 PLN00032 DNA-directed RNA poly  38.0      16 0.00034   25.9   0.8   12   19-30      3-14  (71)
 22 PF13248 zf-ribbon_3:  zinc-rib  36.7      13 0.00029   20.6   0.3   13   21-33      3-15  (26)
 23 PF01922 SRP19:  SRP19 protein;  36.6     8.8 0.00019   27.5  -0.6   23   26-48     16-38  (95)
 24 COG2888 Predicted Zn-ribbon RN  34.4      31 0.00068   23.8   1.8   36   18-54      7-43  (61)
 25 KOG3408 U1-like Zn-finger-cont  32.5      14 0.00031   28.8  -0.1   18   62-81     50-67  (129)
 26 PF01194 RNA_pol_N:  RNA polyme  32.1      15 0.00032   25.1  -0.1   13   19-31      3-15  (60)
 27 PRK12286 rpmF 50S ribosomal pr  26.2      41 0.00088   22.3   1.3   29    2-30      4-37  (57)
 28 KOG3497 DNA-directed RNA polym  26.0      32  0.0007   24.2   0.8   12   19-30      3-14  (69)
 29 PF13240 zinc_ribbon_2:  zinc-r  25.9      29 0.00063   19.1   0.5   12   22-33      1-12  (23)
 30 PF03604 DNA_RNApol_7kD:  DNA d  25.5      24 0.00051   21.1   0.0   13   18-30     15-27  (32)
 31 PF12230 PRP21_like_P:  Pre-mRN  25.5      23 0.00051   28.2   0.0   32   16-48    164-195 (229)
 32 COG1150 HdrC Heterodisulfide r  25.4      29 0.00063   28.6   0.5   48   21-78     39-89  (195)
 33 PF10589 NADH_4Fe-4S:  NADH-ubi  25.0      20 0.00044   22.5  -0.4   10   24-33     14-23  (46)
 34 COG5134 Uncharacterized conser  24.8      38 0.00082   29.1   1.1   44   20-77     42-85  (272)
 35 PRK14890 putative Zn-ribbon RN  24.5      37 0.00081   23.2   0.9   25   19-44      6-31  (59)
 36 TIGR02174 CXXU_selWTH selT/sel  24.4      31 0.00068   23.1   0.5   14   69-82      1-14  (72)
 37 PF13717 zinc_ribbon_4:  zinc-r  24.3      45 0.00097   19.9   1.1   14   16-29     21-34  (36)
 38 COG1326 Uncharacterized archae  24.3      69  0.0015   26.7   2.5   23   15-37     25-53  (201)
 39 PF06639 BAP:  Basal layer anti  23.8      20 0.00043   25.6  -0.6   22   75-96      5-26  (75)
 40 PF06107 DUF951:  Bacterial pro  23.2      50  0.0011   22.4   1.3   14   20-33     31-46  (57)
 41 KOG3286 Selenoprotein T [Gener  22.9      52  0.0011   27.8   1.5   14   68-81     71-84  (226)
 42 PF07282 OrfB_Zn_ribbon:  Putat  22.3      65  0.0014   20.7   1.7   19   15-33     41-59  (69)
 43 PF13913 zf-C2HC_2:  zinc-finge  21.7      37 0.00079   18.8   0.3   13   20-32      2-14  (25)
 44 PF14353 CpXC:  CpXC protein     20.0      81  0.0017   22.7   1.9   45   21-79      2-46  (128)

No 1  
>PLN00186 ribosomal protein S26; Provisional
Probab=100.00  E-value=8.1e-64  Score=370.58  Aligned_cols=106  Identities=91%  Similarity=1.459  Sum_probs=103.9

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      ||+|||||||+|+|+|||++|+|+|||+|||||||||+|+|+||||+++++||+||+||++|.|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~vy~~y~lPKly~K~~YCVSCAIH   80 (109)
T PLN00186          1 MTKKRRNGGRNKHGRGHVKRIRCSNCGKCVPKDKAIKRFLVRNIVEQAALRDVQEACVYDGYTLPKLYAKVQYCISCAIH   80 (109)
T ss_pred             CCcccccCCCCCCCCCCCcceeeCCCcccccccceEEEEecccCccHHHHHHHHhhhcccccccchhhhceEEEEeehhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCchhhccCCCCCCCcCCCC
Q 032843           81 SHVVRVRSRTNRRIREPPQRFRRRDD  106 (132)
Q Consensus        81 skVVRvRS~e~RK~r~pp~r~~~~~~  106 (132)
                      ++||||||+|+||+|+||++|++.++
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~~~  106 (109)
T PLN00186         81 SRVVRVRSRENRRIREPPPRFRRRKD  106 (109)
T ss_pred             cceeecCChHHccccCCCcccccccc
Confidence            99999999999999999999988554


No 2  
>PF01283 Ribosomal_S26e:  Ribosomal protein S26e;  InterPro: IPR000892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. One of these families, the S26E family, includes mammalian S26 []; Octopus S26 []; Drosophila S26 (DS31) []; plant cytoplasmic S26; and fungal S26 []. These proteins have 114 to 127 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_a 3U5C_a 2XZM_5 2XZN_5.
Probab=100.00  E-value=2.4e-64  Score=375.12  Aligned_cols=110  Identities=68%  Similarity=1.171  Sum_probs=73.0

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      ||+|||||||+|+|+|||++|+|+|||+|||||||||+|+|+||||++++|||+|||||++|+|||||+|+|||||||||
T Consensus         1 M~~KRrN~Gr~KkgrGhv~~V~C~nCgr~vPKDKAIkrf~i~niVeaaa~rdi~~a~v~~~y~lPKlyvK~~YCvSCAIH   80 (113)
T PF01283_consen    1 MTKKRRNNGRSKKGRGHVQPVRCDNCGRCVPKDKAIKRFVIRNIVEAAAVRDISEASVYDAYVLPKLYVKLYYCVSCAIH   80 (113)
T ss_dssp             -----TTTTSS-SSSS---EEE-TTTB-EEECCCSEEEEEEEESS-CCCHHHHHHCB-SSS--S-EEEEEEEE-CHHHHH
T ss_pred             CCcccccCCCCCCCCCCCcCEeeCcccccCcCCceEEEEEccCCccHHHHHHHhhcceeeecccccceeEEEEeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCchhhccCCCCCCCcCCCCCCCC
Q 032843           81 SHVVRVRSRTNRRIREPPQRFRRRDDVPKA  110 (132)
Q Consensus        81 skVVRvRS~e~RK~r~pp~r~~~~~~~~~~  110 (132)
                      ++|||+||+|+||+|+||++|++..+..++
T Consensus        81 ~~IVr~Rs~e~RK~r~~p~~~~~~~~~~~~  110 (113)
T PF01283_consen   81 SKIVRVRSREERKDRTPPPRFRPRKQGQKP  110 (113)
T ss_dssp             TTSS----TCCCC--S--------------
T ss_pred             ccccccCChHHccccCCCCcCCcccccccc
Confidence            999999999999999999999987665543


No 3  
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=100.00  E-value=2.5e-63  Score=367.48  Aligned_cols=104  Identities=74%  Similarity=1.227  Sum_probs=101.9

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      ||+|||||||+|+|+|||++|+|+|||+|||||||||+|+|+||||+++++||+||+||++|+|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~v~~~y~lPKly~k~~YCVSCAIH   80 (108)
T PTZ00172          1 MTSKRRNNGRSKHGRGHVKPVRCSNCGRCVPKDKAIKRFVVRNIVDAASVRDIAEASVYYGYPLPKLYMKQQYCVSCAIH   80 (108)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCccccccccceEEEEeccCCccHHHHHHHHHhhchhccccccceeeeEEeeehhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCchhhccCCCCCCCcCC
Q 032843           81 SHVVRVRSRTNRRIREPPQRFRRR  104 (132)
Q Consensus        81 skVVRvRS~e~RK~r~pp~r~~~~  104 (132)
                      ++||||||+|+||+|+||+++...
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~  104 (108)
T PTZ00172         81 SRVVRVRSREDRKIRTPPKRPFRP  104 (108)
T ss_pred             CCeeecCChHHccccCCCCCCCCC
Confidence            999999999999999999887653


No 4  
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=100.00  E-value=2.3e-57  Score=329.58  Aligned_cols=94  Identities=30%  Similarity=0.658  Sum_probs=92.2

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      ||+|||||||+|+|+||+++|+|+|||+|||||||||+|+|+||||+++++||+||++|    |||||+|+|||||||||
T Consensus         1 M~kKRrn~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~i~n~Ve~a~~rdl~~a~~~----lpk~~~k~~YCvSCAiH   76 (95)
T PRK09335          1 MPKKRENRGRRKGDKGHVGYVQCDNCGRRVPRDKAVCVTKMYSPVDPQLAKELEKKGAI----IARYPVTKCYCVNCAVH   76 (95)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCCCCcCcCCceEEEEEecCCCCHHHHHHHHhCcee----eeeeeeeeEEechhhhh
Confidence            99999999999999999999999999999999999999999999999999999999987    99999999999999999


Q ss_pred             cccccccCchhhccCCCC
Q 032843           81 SHVVRVRSRTNRRIREPP   98 (132)
Q Consensus        81 skVVRvRS~e~RK~r~pp   98 (132)
                      ++|||+||+|+||+|+|.
T Consensus        77 ~~IVrvRs~e~Rk~r~~~   94 (95)
T PRK09335         77 LGIIKIRPEEERKKKAPL   94 (95)
T ss_pred             ccccccCChHHcccccCC
Confidence            999999999999999863


No 5  
>KOG1768 consensus 40s ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=4.4e-55  Score=326.25  Aligned_cols=109  Identities=71%  Similarity=1.187  Sum_probs=104.5

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      ||+||+|+|++|+|+||+.+|+|+||++|||||||||+|+|+||||++++|||+|||||++|+|||||+|||||||||||
T Consensus         1 m~~kr~~~gr~k~~~g~v~~i~c~~c~~~~~kdKaIk~f~i~niVEaaavrdiseasv~d~y~~pKly~Klhycvscaih   80 (115)
T KOG1768|consen    1 MTKKRRNAGRNKKGRGHVIPIRCTNCGRCMPKDKAIKRFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIH   80 (115)
T ss_pred             CCcccccCCCCCCCCcceeeeeeccccccchHHHHHHHHHHHHHHHHHHhhhhhhheeccccccccccceeeeeEeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCchhhccCCCCCCCcCCCCCCC
Q 032843           81 SHVVRVRSRTNRRIREPPQRFRRRDDVPK  109 (132)
Q Consensus        81 skVVRvRS~e~RK~r~pp~r~~~~~~~~~  109 (132)
                      ++|||+||.|.||+|+||++|.+.....+
T Consensus        81 skVvR~rS~e~rrir~pp~rf~~~~~~~~  109 (115)
T KOG1768|consen   81 SKVVRVRSREARRIRTPPPRFSPRAPSLR  109 (115)
T ss_pred             eeeeccchhhhhcccCCCcccCccccccC
Confidence            99999999999999999998877544333


No 6  
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=8.2e-52  Score=304.96  Aligned_cols=97  Identities=65%  Similarity=1.129  Sum_probs=96.6

Q ss_pred             CCcccccCCCCCCCCCccceEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeecee
Q 032843            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   80 (132)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAIH   80 (132)
                      |||||+||||+|+|+||+.+|+|+|||..||||||||+|.|+|+||+++++||+++++|+.|.+||+|.|+|||||||||
T Consensus         1 mpkkR~N~GR~K~~rGhv~~v~CdnCg~~vPkdKAikr~~i~s~Ve~a~~rdL~~asIy~~y~vpk~~~k~qyCVsCAih   80 (108)
T COG4830           1 MPKKRRNRGRNKKGRGHVKYVRCDNCGKAVPKDKAIKRTAIRSPVEAAAARDLSEASIYSEYAVPKTYNKLQYCVSCAIH   80 (108)
T ss_pred             CcchhhhcCCCCCCCCCccceeeccccccCCccceeeEeeccCcccHHHHHHHhhceeeeeeeccccccceeeeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCchhhccCCC
Q 032843           81 SHVVRVRSRTNRRIREP   97 (132)
Q Consensus        81 skVVRvRS~e~RK~r~p   97 (132)
                      ++||||||+|+||++.|
T Consensus        81 ~~IvrVRSre~RK~r~p   97 (108)
T COG4830          81 ARIVRVRSREERKIRAP   97 (108)
T ss_pred             eeEEEEecchhhhhcCC
Confidence            99999999999999998


No 7  
>COG1400 SEC65 Signal recognition particle 19 kDa protein [Intracellular trafficking and secretion]
Probab=73.10  E-value=0.78  Score=33.64  Aligned_cols=26  Identities=27%  Similarity=0.516  Sum_probs=21.7

Q ss_pred             cceeecccceeeeeecccchhhHHhhHH
Q 032843           27 GKCCPKDKAIKRFLVRNIVEQAAVRDVQ   54 (132)
Q Consensus        27 gr~vPKDKAIKrf~irNiVEaaavrDis   54 (132)
                      ||+|||+.||..+...+|+|+  +++|-
T Consensus        20 GRrvpk~laV~~P~~~ei~~a--~~~LG   45 (93)
T COG1400          20 GRRVPKELAVENPSLEEIAEA--LRELG   45 (93)
T ss_pred             ccccchhhcccCCCHHHHHHH--HHHcC
Confidence            599999999999999999875  55554


No 8  
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=56.88  E-value=7.2  Score=23.61  Aligned_cols=15  Identities=27%  Similarity=0.895  Sum_probs=10.4

Q ss_pred             cceEeecCCcceeec
Q 032843           18 VKFIRCSNCGKCCPK   32 (132)
Q Consensus        18 v~~V~C~NCgr~vPK   32 (132)
                      ...+.|.||+|-|.-
T Consensus         2 ~~~~~C~nC~R~v~a   16 (33)
T PF08209_consen    2 SPYVECPNCGRPVAA   16 (33)
T ss_dssp             S-EEE-TTTSSEEEG
T ss_pred             CCeEECCCCcCCcch
Confidence            467899999998753


No 9  
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=56.71  E-value=4.6  Score=24.59  Aligned_cols=14  Identities=57%  Similarity=1.212  Sum_probs=8.8

Q ss_pred             CCccceEeecCCcc
Q 032843           15 RGHVKFIRCSNCGK   28 (132)
Q Consensus        15 rGhv~~V~C~NCgr   28 (132)
                      |=|-++|-|++||=
T Consensus        16 R~~~~~isC~~CGP   29 (35)
T PF07503_consen   16 RFHYQFISCTNCGP   29 (35)
T ss_dssp             TTT-TT--BTTCC-
T ss_pred             cccCcCccCCCCCC
Confidence            46889999999993


No 10 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=54.08  E-value=6.7  Score=25.03  Aligned_cols=13  Identities=31%  Similarity=0.848  Sum_probs=10.4

Q ss_pred             cceEeecCCccee
Q 032843           18 VKFIRCSNCGKCC   30 (132)
Q Consensus        18 v~~V~C~NCgr~v   30 (132)
                      ...+.|.||||.+
T Consensus        44 ~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   44 DEIVFCPNCGRIL   56 (56)
T ss_pred             CCeEECcCCCccC
Confidence            4678999999863


No 11 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=46.36  E-value=15  Score=24.17  Aligned_cols=28  Identities=25%  Similarity=0.675  Sum_probs=18.3

Q ss_pred             CcccccCCCCCCCCCc------cceEeecCCcce
Q 032843            2 TFKRRNGGRNKHGRGH------VKFIRCSNCGKC   29 (132)
Q Consensus         2 ~kKRrNnGR~KkgrGh------v~~V~C~NCgr~   29 (132)
                      ||+|-+..|..+=|.|      ...+.|.+||..
T Consensus         2 PKrk~Sksr~~~RRah~~kl~~p~l~~C~~cG~~   35 (55)
T TIGR01031         2 PKRKTSKSRKRKRRSHDAKLTAPTLVVCPNCGEF   35 (55)
T ss_pred             CCCcCCcccccchhcCcccccCCcceECCCCCCc
Confidence            5555555555555555      457889999963


No 12 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=44.17  E-value=11  Score=25.99  Aligned_cols=14  Identities=36%  Similarity=0.781  Sum_probs=11.5

Q ss_pred             ceEeecCCcceeec
Q 032843           19 KFIRCSNCGKCCPK   32 (132)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (132)
                      -||+|..||+.+--
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            48999999997743


No 13 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=43.67  E-value=9.2  Score=25.84  Aligned_cols=17  Identities=35%  Similarity=0.735  Sum_probs=14.7

Q ss_pred             EeecCCcceeeccccee
Q 032843           21 IRCSNCGKCCPKDKAIK   37 (132)
Q Consensus        21 V~C~NCgr~vPKDKAIK   37 (132)
                      -||-+||.-+|-|++..
T Consensus         4 kHC~~CG~~Ip~~~~fC   20 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFC   20 (59)
T ss_pred             CcCCcCCCcCCcchhhh
Confidence            37999999999998765


No 14 
>PF04726 Microvir_J:  Microvirus J protein;  InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=43.24  E-value=13  Score=21.37  Aligned_cols=15  Identities=53%  Similarity=0.851  Sum_probs=7.7

Q ss_pred             CCcccccCCCCCCCC
Q 032843            1 MTFKRRNGGRNKHGR   15 (132)
Q Consensus         1 M~kKRrNnGR~Kkgr   15 (132)
                      |-++||+.|++|+.|
T Consensus         1 ~k~~rrs~~~~kgar   15 (24)
T PF04726_consen    1 MKSKRRSGGKRKGAR   15 (24)
T ss_dssp             --GGGS---SSSSS-
T ss_pred             CcccccCCCccCceE
Confidence            567899999999865


No 15 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=43.19  E-value=11  Score=26.24  Aligned_cols=13  Identities=38%  Similarity=0.772  Sum_probs=10.7

Q ss_pred             ceEeecCCcceee
Q 032843           19 KFIRCSNCGKCCP   31 (132)
Q Consensus        19 ~~V~C~NCgr~vP   31 (132)
                      -||||-+||+.+-
T Consensus         3 iPiRCFsCGkvi~   15 (63)
T COG1644           3 IPVRCFSCGKVIG   15 (63)
T ss_pred             CceEeecCCCCHH
Confidence            4899999998653


No 16 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.84  E-value=14  Score=25.41  Aligned_cols=13  Identities=38%  Similarity=0.838  Sum_probs=10.0

Q ss_pred             cceEeecCCccee
Q 032843           18 VKFIRCSNCGKCC   30 (132)
Q Consensus        18 v~~V~C~NCgr~v   30 (132)
                      --.|.|+|||+.|
T Consensus        32 DIkikC~nC~h~v   44 (60)
T COG4481          32 DIKIKCENCGHSV   44 (60)
T ss_pred             cEEEEecCCCcEE
Confidence            3468899999954


No 17 
>KOG2612 consensus Predicted integral membrane protein [Function unknown]
Probab=41.68  E-value=8.9  Score=28.68  Aligned_cols=15  Identities=20%  Similarity=0.430  Sum_probs=11.9

Q ss_pred             ccceEeecCCcceee
Q 032843           17 HVKFIRCSNCGKCCP   31 (132)
Q Consensus        17 hv~~V~C~NCgr~vP   31 (132)
                      ..+.++|.||+|.|-
T Consensus        71 k~~~~hCeNC~RdVa   85 (103)
T KOG2612|consen   71 KPMDCHCENCDRDVA   85 (103)
T ss_pred             CCccccCCCCccHHH
Confidence            456899999999763


No 18 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=39.84  E-value=14  Score=23.82  Aligned_cols=11  Identities=55%  Similarity=1.428  Sum_probs=8.1

Q ss_pred             eEEeeee-ceec
Q 032843           71 MQYCVSC-AIHS   81 (132)
Q Consensus        71 l~YCVSC-AIHs   81 (132)
                      .+|||+| -||.
T Consensus         1 MyYCi~Cs~~h~   12 (41)
T PF13119_consen    1 MYYCINCSEIHH   12 (41)
T ss_pred             CEEEEEhHHhHH
Confidence            3799999 5663


No 19 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=38.67  E-value=11  Score=29.11  Aligned_cols=31  Identities=23%  Similarity=0.345  Sum_probs=19.8

Q ss_pred             HHhhHHhhccccc----cccccceeeeEEeeeeceec
Q 032843           49 AVRDVQEACVYDG----YTLPKLYAKMQYCVSCAIHS   81 (132)
Q Consensus        49 avrDiseAsv~~~----y~lPKlyvKl~YCVSCAIHs   81 (132)
                      .-.||++..-++-    -.||-  .-.|||+.||-|.
T Consensus        31 i~nDls~~Es~~Klp~Dp~lPG--lGqhYCieCaryf   65 (126)
T COG5112          31 IKNDLSTKESQKKLPYDPELPG--LGQHYCIECARYF   65 (126)
T ss_pred             HHHhcchhhhhccCCCCCCCCC--CceeeeehhHHHH
Confidence            3567766554432    23443  4689999999774


No 20 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=38.13  E-value=15  Score=24.56  Aligned_cols=18  Identities=39%  Similarity=0.711  Sum_probs=13.7

Q ss_pred             ceEeecCCcceeecccce
Q 032843           19 KFIRCSNCGKCCPKDKAI   36 (132)
Q Consensus        19 ~~V~C~NCgr~vPKDKAI   36 (132)
                      +-|||.+|++++-+-..+
T Consensus         3 ~eiRC~~CnklLa~~g~~   20 (51)
T PF10122_consen    3 KEIRCGHCNKLLAKAGEV   20 (51)
T ss_pred             cceeccchhHHHhhhcCc
Confidence            579999999988774333


No 21 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=38.04  E-value=16  Score=25.88  Aligned_cols=12  Identities=42%  Similarity=0.869  Sum_probs=10.3

Q ss_pred             ceEeecCCccee
Q 032843           19 KFIRCSNCGKCC   30 (132)
Q Consensus        19 ~~V~C~NCgr~v   30 (132)
                      -||||-.||+.+
T Consensus         3 iPVRCFTCGkvi   14 (71)
T PLN00032          3 IPVRCFTCGKVI   14 (71)
T ss_pred             CceeecCCCCCc
Confidence            389999999866


No 22 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=36.72  E-value=13  Score=20.63  Aligned_cols=13  Identities=38%  Similarity=0.820  Sum_probs=9.7

Q ss_pred             EeecCCcceeecc
Q 032843           21 IRCSNCGKCCPKD   33 (132)
Q Consensus        21 V~C~NCgr~vPKD   33 (132)
                      +.|.|||.-++.|
T Consensus         3 ~~Cp~Cg~~~~~~   15 (26)
T PF13248_consen    3 MFCPNCGAEIDPD   15 (26)
T ss_pred             CCCcccCCcCCcc
Confidence            5688888876665


No 23 
>PF01922 SRP19:  SRP19 protein;  InterPro: IPR002778  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the SRP19 subunit. The SRP19 protein is unstructured but forms a compact core domain and two extended RNA-binding loops upon binding the signal recognition particle (SRP) RNA [].; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle; PDB: 3DLU_A 3DLV_B 2J37_B 1MFQ_B 3KTV_D 1RY1_B 1JID_A 1KVV_A 1KVN_A 3KTW_B ....
Probab=36.56  E-value=8.8  Score=27.51  Aligned_cols=23  Identities=22%  Similarity=0.401  Sum_probs=14.9

Q ss_pred             Ccceeecccceeeeeecccchhh
Q 032843           26 CGKCCPKDKAIKRFLVRNIVEQA   48 (132)
Q Consensus        26 Cgr~vPKDKAIKrf~irNiVEaa   48 (132)
                      -||.|||+.|+..-.+..|.++.
T Consensus        16 ~GRrv~k~~aV~~P~~~EI~~a~   38 (95)
T PF01922_consen   16 EGRRVPKELAVENPTLEEIADAC   38 (95)
T ss_dssp             TT--SSTTTSBSS--HHHHHHHH
T ss_pred             hccccChhhcCCCCCHHHHHHHH
Confidence            47999999999877777776654


No 24 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=34.44  E-value=31  Score=23.83  Aligned_cols=36  Identities=28%  Similarity=0.422  Sum_probs=26.6

Q ss_pred             cceEeecCCccee-ecccceeeeeecccchhhHHhhHH
Q 032843           18 VKFIRCSNCGKCC-PKDKAIKRFLVRNIVEQAAVRDVQ   54 (132)
Q Consensus        18 v~~V~C~NCgr~v-PKDKAIKrf~irNiVEaaavrDis   54 (132)
                      ..+-.|++||+-+ |..++++ |.--|-=|....|...
T Consensus         7 ~~~~~CtSCg~~i~p~e~~v~-F~CPnCGe~~I~Rc~~   43 (61)
T COG2888           7 KDPPVCTSCGREIAPGETAVK-FPCPNCGEVEIYRCAK   43 (61)
T ss_pred             cCCceeccCCCEeccCCceeE-eeCCCCCceeeehhhh
Confidence            3456899999999 8878776 8888776666655543


No 25 
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=32.48  E-value=14  Score=28.80  Aligned_cols=18  Identities=33%  Similarity=0.598  Sum_probs=13.1

Q ss_pred             cccccceeeeEEeeeeceec
Q 032843           62 YTLPKLYAKMQYCVSCAIHS   81 (132)
Q Consensus        62 y~lPKlyvKl~YCVSCAIHs   81 (132)
                      +-||-  .-++||+-||-|.
T Consensus        50 ~dlPG--~GqfyCi~CaRyF   67 (129)
T KOG3408|consen   50 PDLPG--GGQFYCIECARYF   67 (129)
T ss_pred             CCCCC--Cceeehhhhhhhh
Confidence            44553  4589999999774


No 26 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=32.05  E-value=15  Score=25.11  Aligned_cols=13  Identities=38%  Similarity=0.761  Sum_probs=9.5

Q ss_pred             ceEeecCCcceee
Q 032843           19 KFIRCSNCGKCCP   31 (132)
Q Consensus        19 ~~V~C~NCgr~vP   31 (132)
                      -||||-.||+.+-
T Consensus         3 iPVRCFTCGkvi~   15 (60)
T PF01194_consen    3 IPVRCFTCGKVIG   15 (60)
T ss_dssp             -SSS-STTTSBTC
T ss_pred             CceecCCCCCChh
Confidence            3899999998774


No 27 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=26.16  E-value=41  Score=22.32  Aligned_cols=29  Identities=24%  Similarity=0.608  Sum_probs=16.7

Q ss_pred             CcccccCCCCCCCCCc-----cceEeecCCccee
Q 032843            2 TFKRRNGGRNKHGRGH-----VKFIRCSNCGKCC   30 (132)
Q Consensus         2 ~kKRrNnGR~KkgrGh-----v~~V~C~NCgr~v   30 (132)
                      ||+|-+..|..+=|.|     ...+.|.+||-..
T Consensus         4 PKrk~S~srr~~RRsh~~l~~~~l~~C~~CG~~~   37 (57)
T PRK12286          4 PKRKTSKSRKRKRRAHFKLKAPGLVECPNCGEPK   37 (57)
T ss_pred             CcCcCChhhcchhcccccccCCcceECCCCCCcc
Confidence            4555555444444455     3466799998643


No 28 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=25.95  E-value=32  Score=24.16  Aligned_cols=12  Identities=50%  Similarity=0.894  Sum_probs=10.0

Q ss_pred             ceEeecCCccee
Q 032843           19 KFIRCSNCGKCC   30 (132)
Q Consensus        19 ~~V~C~NCgr~v   30 (132)
                      -||||-.||..+
T Consensus         3 iPiRCFtCGKvi   14 (69)
T KOG3497|consen    3 IPIRCFTCGKVI   14 (69)
T ss_pred             eeeEeeeccccc
Confidence            389999999865


No 29 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=25.89  E-value=29  Score=19.07  Aligned_cols=12  Identities=42%  Similarity=0.894  Sum_probs=9.3

Q ss_pred             eecCCcceeecc
Q 032843           22 RCSNCGKCCPKD   33 (132)
Q Consensus        22 ~C~NCgr~vPKD   33 (132)
                      .|.+||.-++.|
T Consensus         1 ~Cp~CG~~~~~~   12 (23)
T PF13240_consen    1 YCPNCGAEIEDD   12 (23)
T ss_pred             CCcccCCCCCCc
Confidence            388999888755


No 30 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=25.49  E-value=24  Score=21.10  Aligned_cols=13  Identities=38%  Similarity=0.777  Sum_probs=9.3

Q ss_pred             cceEeecCCccee
Q 032843           18 VKFIRCSNCGKCC   30 (132)
Q Consensus        18 v~~V~C~NCgr~v   30 (132)
                      ..+|+|.+||--+
T Consensus        15 ~~~irC~~CG~RI   27 (32)
T PF03604_consen   15 GDPIRCPECGHRI   27 (32)
T ss_dssp             SSTSSBSSSS-SE
T ss_pred             CCcEECCcCCCeE
Confidence            3579999999643


No 31 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=25.46  E-value=23  Score=28.17  Aligned_cols=32  Identities=19%  Similarity=0.349  Sum_probs=0.0

Q ss_pred             CccceEeecCCcceeecccceeeeeecccchhh
Q 032843           16 GHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQA   48 (132)
Q Consensus        16 Ghv~~V~C~NCgr~vPKDKAIKrf~irNiVEaa   48 (132)
                      ..+..+.|..||..||-|+-=. -+--+++|+.
T Consensus       164 ~~~~~~~cPitGe~IP~~e~~e-HmRi~LlDP~  195 (229)
T PF12230_consen  164 PKEKMIICPITGEMIPADEMDE-HMRIELLDPR  195 (229)
T ss_dssp             ---------------------------------
T ss_pred             cccccccccccccccccccccc-cccccccccc
Confidence            3567899999999999998654 2223344443


No 32 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=25.45  E-value=29  Score=28.58  Aligned_cols=48  Identities=27%  Similarity=0.680  Sum_probs=34.1

Q ss_pred             EeecCCcce---eecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeec
Q 032843           21 IRCSNCGKC---CPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCA   78 (132)
Q Consensus        21 V~C~NCgr~---vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCA   78 (132)
                      -.|.|||-|   +|--.. -.|..|-||.-+...|.+  .++...       .+++|++|-
T Consensus        39 ~~C~QCG~CT~sCPs~r~-t~y~pR~ii~~~~~g~~d--~il~~~-------~lW~C~tCy   89 (195)
T COG1150          39 EGCYQCGTCTGSCPSGRF-TDYSPRKIIRKARLGLVD--LILSSE-------SLWACVTCY   89 (195)
T ss_pred             hHhhccCcccCCCCCccc-CCCCHHHHHHHHHcccHH--HHhcCC-------cceeeeech
Confidence            347777776   577777 678889999888877665  344333       368899983


No 33 
>PF10589 NADH_4Fe-4S:  NADH-ubiquinone oxidoreductase-F iron-sulfur binding region;  InterPro: IPR019575  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the F subunit of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2.  This entry represents the iron-sulphur binding domain of the F subunit.; GO: 0055114 oxidation-reduction process; PDB: 3IAS_S 2FUG_A 3I9V_A 3M9S_1 3IAM_A 2YBB_1.
Probab=24.97  E-value=20  Score=22.47  Aligned_cols=10  Identities=50%  Similarity=1.262  Sum_probs=4.2

Q ss_pred             cCCcceeecc
Q 032843           24 SNCGKCCPKD   33 (132)
Q Consensus        24 ~NCgr~vPKD   33 (132)
                      .+||+|+|-=
T Consensus        14 ESCGkC~PCR   23 (46)
T PF10589_consen   14 ESCGKCTPCR   23 (46)
T ss_dssp             H--S--HHHH
T ss_pred             cCCCCCCCcH
Confidence            5799999953


No 34 
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=24.81  E-value=38  Score=29.07  Aligned_cols=44  Identities=27%  Similarity=0.443  Sum_probs=27.1

Q ss_pred             eEeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeee
Q 032843           20 FIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSC   77 (132)
Q Consensus        20 ~V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSC   77 (132)
                      +|+|-||+-.+||.+-.           .++++|-..--|.+.   |.|.-..-|--|
T Consensus        42 ~~RCL~C~~YI~K~~rf-----------NavkE~~~dK~y~~~---kiYRf~I~C~~C   85 (272)
T COG5134          42 PVRCLNCENYIQKGTRF-----------NAVKEEIGDKSYYTT---KIYRFSIKCHLC   85 (272)
T ss_pred             ceeecchhhhhhcccch-----------hHHHHHhccccccee---EEEEEEEEccCC
Confidence            79999999999998632           246666543334333   445444444444


No 35 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=24.53  E-value=37  Score=23.19  Aligned_cols=25  Identities=40%  Similarity=0.860  Sum_probs=17.7

Q ss_pred             ceEeecCCcc-eeecccceeeeeeccc
Q 032843           19 KFIRCSNCGK-CCPKDKAIKRFLVRNI   44 (132)
Q Consensus        19 ~~V~C~NCgr-~vPKDKAIKrf~irNi   44 (132)
                      .+..|++||+ +.|.+++.+ |.=-|=
T Consensus         6 ~~~~CtSCg~~i~~~~~~~~-F~CPnC   31 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKAVK-FLCPNC   31 (59)
T ss_pred             cCccccCCCCcccCCCccCE-eeCCCC
Confidence            4557999998 556888875 665554


No 36 
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=24.37  E-value=31  Score=23.09  Aligned_cols=14  Identities=29%  Similarity=0.871  Sum_probs=10.1

Q ss_pred             eeeEEeeeeceecc
Q 032843           69 AKMQYCVSCAIHSH   82 (132)
Q Consensus        69 vKl~YCVSCAIHsk   82 (132)
                      |...||.+|-...+
T Consensus         1 V~IeyC~~C~y~~R   14 (72)
T TIGR02174         1 VEIEYCGSCGYKPR   14 (72)
T ss_pred             CEEEECCCCCChHH
Confidence            46789999975443


No 37 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=24.31  E-value=45  Score=19.94  Aligned_cols=14  Identities=36%  Similarity=0.859  Sum_probs=10.9

Q ss_pred             CccceEeecCCcce
Q 032843           16 GHVKFIRCSNCGKC   29 (132)
Q Consensus        16 Ghv~~V~C~NCgr~   29 (132)
                      ++...|+|++|+..
T Consensus        21 ~~g~~v~C~~C~~~   34 (36)
T PF13717_consen   21 PKGRKVRCSKCGHV   34 (36)
T ss_pred             CCCcEEECCCCCCE
Confidence            45568999999864


No 38 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.29  E-value=69  Score=26.67  Aligned_cols=23  Identities=35%  Similarity=0.902  Sum_probs=16.3

Q ss_pred             CCccceEeecCCccee------eccccee
Q 032843           15 RGHVKFIRCSNCGKCC------PKDKAIK   37 (132)
Q Consensus        15 rGhv~~V~C~NCgr~v------PKDKAIK   37 (132)
                      +|..-.++|.|||-.-      ||-..++
T Consensus        25 ~g~~~lvrC~eCG~V~~~~i~~~k~~~v~   53 (201)
T COG1326          25 RGREPLVRCEECGTVHPAIIKTPKPVRVR   53 (201)
T ss_pred             cCCceEEEccCCCcEeeceeeccccceEE
Confidence            4555899999999865      4555554


No 39 
>PF06639 BAP:  Basal layer antifungal peptide (BAP);  InterPro: IPR009540 This family consists of several basal layer antifungal peptide (BAP) sequences specific to Zea mays (Maize). The BAP2 peptide exhibits potent broad-range activity against a range of filamentous fungi, including several plant pathogens [].
Probab=23.77  E-value=20  Score=25.64  Aligned_cols=22  Identities=23%  Similarity=0.610  Sum_probs=17.7

Q ss_pred             eeeceecccccccCchhhccCC
Q 032843           75 VSCAIHSHVVRVRSRTNRRIRE   96 (132)
Q Consensus        75 VSCAIHskVVRvRS~e~RK~r~   96 (132)
                      -||.||++|++=+-+|+-.-+.
T Consensus         5 AS~V~hA~ii~Gqtke~~nt~s   26 (75)
T PF06639_consen    5 ASCVIHAHIISGQTKEDSNTGS   26 (75)
T ss_pred             hhhHhhHHhhcCceeeccCCCc
Confidence            4899999999998888765443


No 40 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=23.18  E-value=50  Score=22.42  Aligned_cols=14  Identities=36%  Similarity=0.973  Sum_probs=10.6

Q ss_pred             eEeecCCcce--eecc
Q 032843           20 FIRCSNCGKC--CPKD   33 (132)
Q Consensus        20 ~V~C~NCgr~--vPKD   33 (132)
                      .+.|++||+.  +|+-
T Consensus        31 kikC~gCg~~imlpR~   46 (57)
T PF06107_consen   31 KIKCLGCGRQIMLPRS   46 (57)
T ss_pred             EEEECCCCCEEEEeHH
Confidence            5789999994  4553


No 41 
>KOG3286 consensus Selenoprotein T [General function prediction only]
Probab=22.85  E-value=52  Score=27.82  Aligned_cols=14  Identities=29%  Similarity=0.847  Sum_probs=11.2

Q ss_pred             eeeeEEeeeeceec
Q 032843           68 YAKMQYCVSCAIHS   81 (132)
Q Consensus        68 yvKl~YCVSCAIHs   81 (132)
                      -++..|||||-.-.
T Consensus        71 tl~i~fCvSCgYk~   84 (226)
T KOG3286|consen   71 TLEINFCVSCGYKQ   84 (226)
T ss_pred             cEEEEEEEecCcHH
Confidence            47899999997644


No 42 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=22.34  E-value=65  Score=20.69  Aligned_cols=19  Identities=32%  Similarity=0.651  Sum_probs=12.9

Q ss_pred             CCccceEeecCCcceeecc
Q 032843           15 RGHVKFIRCSNCGKCCPKD   33 (132)
Q Consensus        15 rGhv~~V~C~NCgr~vPKD   33 (132)
                      ....+...|.+||..+..|
T Consensus        41 ~~~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   41 RRSGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             ccccceEEcCCCCCEECcH
Confidence            3455566788888777666


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=21.70  E-value=37  Score=18.80  Aligned_cols=13  Identities=23%  Similarity=0.743  Sum_probs=10.2

Q ss_pred             eEeecCCcceeec
Q 032843           20 FIRCSNCGKCCPK   32 (132)
Q Consensus        20 ~V~C~NCgr~vPK   32 (132)
                      .+.|.+|||-..-
T Consensus         2 l~~C~~CgR~F~~   14 (25)
T PF13913_consen    2 LVPCPICGRKFNP   14 (25)
T ss_pred             CCcCCCCCCEECH
Confidence            5789999997643


No 44 
>PF14353 CpXC:  CpXC protein
Probab=20.00  E-value=81  Score=22.71  Aligned_cols=45  Identities=27%  Similarity=0.530  Sum_probs=26.8

Q ss_pred             EeecCCcceeecccceeeeeecccchhhHHhhHHhhccccccccccceeeeEEeeeece
Q 032843           21 IRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAI   79 (132)
Q Consensus        21 V~C~NCgr~vPKDKAIKrf~irNiVEaaavrDiseAsv~~~y~lPKlyvKl~YCVSCAI   79 (132)
                      |.|.+||.-.-       +.+..+|+++.--|+.++-. +|-..      .+-|.+|.-
T Consensus         2 itCP~C~~~~~-------~~v~~~I~~~~~p~l~e~il-~g~l~------~~~CP~Cg~   46 (128)
T PF14353_consen    2 ITCPHCGHEFE-------FEVWTSINADEDPELKEKIL-DGSLF------SFTCPSCGH   46 (128)
T ss_pred             cCCCCCCCeeE-------EEEEeEEcCcCCHHHHHHHH-cCCcC------EEECCCCCC
Confidence            67999987543       45555666555555554433 33322      677888854


Done!