BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032863
         (132 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|W Chain W, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|D Chain D, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|K Chain K, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|R Chain R, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 126

 Score =  135 bits (339), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 76/94 (80%)

Query: 4  SLGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHV 63
          S+G+P+K+LHEA GH+VT E  +GE+YRG ++E EDN NCQ+ NIT T +DG+V+QLE V
Sbjct: 2  SIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQV 61

Query: 64 FIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSS 97
          +IRGSK+RF+++PDMLKNAPM K +  + +G  +
Sbjct: 62 YIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGA 95


>pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|S Chain S, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|T Chain T, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|U Chain U, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 126

 Score =  132 bits (333), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 75/94 (79%)

Query: 4  SLGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHV 63
          S+G+P+K+LHEA GH+VT E  +GE+YRG ++E EDN NCQ+ NIT T +DG+V+QLE V
Sbjct: 2  SIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQV 61

Query: 64 FIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSS 97
          +IRG K+RF+++PDMLKNAPM K +  + +G  +
Sbjct: 62 YIRGCKIRFLILPDMLKNAPMLKSMKNKNQGSGA 95


>pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|C Chain C, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|E Chain E, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|G Chain G, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|I Chain I, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|K Chain K, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 75

 Score =  112 bits (280), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 62/74 (83%)

Query: 4  SLGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHV 63
          S+G+P+K+LHEA GH+VT E  +GE+YRG ++E EDN NCQ+ NIT T +DG+V+QLE V
Sbjct: 2  SIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQV 61

Query: 64 FIRGSKVRFMVIPD 77
          +IRG K+RF+++PD
Sbjct: 62 YIRGCKIRFLILPD 75


>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
          Snrnp Core Domain
 pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|A Chain A, Macromolecular Machine 6
 pdb|4F7U|C Chain C, Macromolecular Machine 6
 pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
 pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
 pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
 pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
 pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
          Length = 119

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%)

Query: 9  VKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRGS 68
          V+ L + S   VT+ELK+G    G++   + + N  L+ +  T K+ +  QLE + IRG+
Sbjct: 4  VRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGN 63

Query: 69 KVRFMVIPDMLKNAPMFKRLDARIKGK 95
           +R+ ++PD L    +   ++ ++K K
Sbjct: 64 NIRYFILPDSLPLDTLLVDVEPKVKSK 90


>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
 pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
 pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
 pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
 pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
 pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
 pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
 pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
 pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
 pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
 pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
 pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
 pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
 pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
 pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
 pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
 pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
 pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
 pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
 pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
 pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
 pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
 pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
 pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
          Length = 105

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 7  IPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDG-KVSQLEHVFI 65
          +P+ LL+   G  + VELK+GE + G +  C++  N  L  +  T  DG K  +L   +I
Sbjct: 16 LPLTLLNATQGRPILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPECYI 75

Query: 66 RGSKVRFMVIPD 77
          RG+ ++++ I D
Sbjct: 76 RGNNIKYLRIQD 87


>pdb|3SWN|B Chain B, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|E Chain E, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|Q Chain Q, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|T Chain T, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 77

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 8  PVKLLHEASGHVVTVELKSGELYRGSMVECEDNW-NCQLENITYTAKDGKVSQLEHVFIR 66
          P + L++  G  V + L SG  Y+G ++ C D + N  LE         K +     FIR
Sbjct: 7  PNEFLNKVIGKKVLIRLSSGVDYKG-ILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIR 65

Query: 67 GSKVRFMVIPD 77
          G+ V ++   D
Sbjct: 66 GNNVLYVSALD 76


>pdb|4EMK|B Chain B, Crystal Structure Of Splsm567
          Length = 75

 Score = 30.0 bits (66), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 8  PVKLLHEASGHVVTVELKSGELYRGSMVECEDNW-NCQLENITYTAKDGKVSQLEHVFIR 66
          P + L++  G  V + L SG  Y+G ++ C D + N  LE         K +     FIR
Sbjct: 5  PNEFLNKVIGKKVLIRLSSGVDYKG-ILSCLDGYXNLALERTEEYVNGKKTNVYGDAFIR 63

Query: 67 GSKVRFMVIPD 77
          G+ V ++   D
Sbjct: 64 GNNVLYVSALD 74


>pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|B Chain B, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|C Chain C, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|D Chain D, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|E Chain E, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|F Chain F, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|G Chain G, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|H Chain H, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|I Chain I, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|J Chain J, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|K Chain K, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|L Chain L, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|M Chain M, Crystal Structure Of Yeast Smf In Spacegroup P43212
 pdb|1N9S|N Chain N, Crystal Structure Of Yeast Smf In Spacegroup P43212
          Length = 93

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 8  PVKLLHEASGHVVTVELK-SGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIR 66
          P   L     H V V+LK +   YRG++V  ++ +N QL              L  +FIR
Sbjct: 22 PKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIR 81

Query: 67 GSKVRFM 73
           + V ++
Sbjct: 82 SNNVLYI 88


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 28.5 bits (62), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 10 KLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRGSK 69
          K+L E+  ++V V+LK  +  RG +   + + N  L +      DG   +L  + IRG  
Sbjct: 12 KVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIVIRGDN 71

Query: 70 V 70
          V
Sbjct: 72 V 72


>pdb|1N9R|A Chain A, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|B Chain B, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|C Chain C, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|D Chain D, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|E Chain E, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|F Chain F, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
 pdb|1N9R|G Chain G, Crystal Structure Of A Heptameric Ring Complex Of Yeast
          Smf In Spacegroup P4122
          Length = 93

 Score = 27.3 bits (59), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 8  PVKLLHEASGHVVTVELK-SGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIR 66
          P   L     H V V+LK +   YRG++V  ++ +N QL              L  +FIR
Sbjct: 22 PKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIR 81

Query: 67 GSKVRFM 73
           + V ++
Sbjct: 82 CNNVLYI 88


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%)

Query: 8  PVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRG 67
          P+ +L+ +    V V LK G  +RG++   + + N  L +         V ++  V IRG
Sbjct: 5  PLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKVGSVVIRG 64

Query: 68 SKVRFM 73
            V F+
Sbjct: 65 DTVVFV 70


>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
          Length = 75

 Score = 26.2 bits (56), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 8  PVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRG 67
          P+ ++H +    V V LK G  +RG ++  + + N  L +         V +   + IRG
Sbjct: 5  PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRG 64

Query: 68 SKV 70
            V
Sbjct: 65 DNV 67


>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
          Length = 77

 Score = 26.2 bits (56), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%)

Query: 8  PVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRG 67
          P+ ++H +    V V LK G  +RG ++  + + N  L +         V +   + IRG
Sbjct: 7  PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRG 66

Query: 68 SKV 70
            V
Sbjct: 67 DNV 69


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,723,667
Number of Sequences: 62578
Number of extensions: 96292
Number of successful extensions: 230
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 219
Number of HSP's gapped (non-prelim): 13
length of query: 132
length of database: 14,973,337
effective HSP length: 88
effective length of query: 44
effective length of database: 9,466,473
effective search space: 416524812
effective search space used: 416524812
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 46 (22.3 bits)