Citrus Sinensis ID: 032863

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--

MSRSLGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSSSIGVGRGRAVAMRAKAAAAGRGAAPGRGVVPPVRR

cccccccHHHHHHHHcccEEEEEEccccEEEEEEEEEcccccEEEEEEEEEcccccEEccccEEECccEEEEEEccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccc

****LGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRGSKVRFMVIPDMLKNAPMFKR*********************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSRSLGIPVKLLHEASGHVVTVELKSGELYRGSMVECEDNWNCQLENITYTAKDGKVSQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSSSIGVGRGRAVAMRAKAAAAGRGAAPGRGVVPPVRR

Annotation	Function Description	Confidence Level	Reference Protein
Small nuclear ribonucleoprotein Sm D3	Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.	probable	P62318
Small nuclear ribonucleoprotein Sm D3	Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing (By similarity). Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.	probable	P62320
Small nuclear ribonucleoprotein Sm D3	Required for pre-mRNA splicing. Required for snRNP biogenesis.	probable	Q17348

No EC number assigned to the protein, probably not an enzyme!

Template: 2Y9A, chain D
Confidence level:very confident
Coverage over the Query: 6-94
View the alignment between query and template
View the model in PyMOL