Query         032883
Match_columns 131
No_of_seqs    70 out of 72
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 07:07:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032883.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032883hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK02724 hypothetical protein;  99.9 6.9E-23 1.5E-27  151.5   4.8   41   89-130     4-44  (104)
  2 CHL00163 ycf65 putative riboso  99.9 8.7E-23 1.9E-27  149.8   4.9   39   91-130     1-39  (99)
  3 cd00732 CheW CheW, a small reg  21.5 1.5E+02  0.0032   20.8   3.5   25   94-119    72-96  (140)
  4 PF14189 DUF4312:  Domain of un  20.7      41 0.00089   24.4   0.5    7  124-130    62-68  (85)
  5 smart00141 PDGF Platelet-deriv  18.2      51  0.0011   23.3   0.5    8  122-129    20-27  (83)
  6 cd00135 PDGF Platelet-derived   17.8      69  0.0015   22.5   1.1    8  122-129    20-27  (86)
  7 cd00588 CheW_like CheW-like do  16.0 1.7E+02  0.0036   19.9   2.6   26   93-119    72-97  (136)
  8 PF09337 zf-H2C2:  His(2)-Cys(2  15.9      39 0.00085   20.8  -0.5   12  118-129    12-23  (39)
  9 PRK09455 rseB anti-sigma E fac  15.1 2.6E+02  0.0055   23.9   4.0   26   84-110   145-170 (319)
 10 PRK13994 potassium-transportin  13.9      79  0.0017   26.6   0.7   16  115-130    75-90  (222)

No 1  
>PRK02724 hypothetical protein; Provisional
Probab=99.87  E-value=6.9e-23  Score=151.48  Aligned_cols=41  Identities=29%  Similarity=0.617  Sum_probs=39.5

Q ss_pred             CCCCeEEEEEEeeeCceEEEeeeeecCCCcccceeeeecccC
Q 032883           89 LEKPRLVLKFIWMEKNIGLALDQSIPGAVAILLLSWMKIPVS  130 (131)
Q Consensus        89 ~~~~rfvLK~LWleknIgiAlDQvv~g~~t~PLT~YfFWPr~  130 (131)
                      .+++||+||||||||||||||||++ |+|++|||+||||||+
T Consensus         4 ~~~~rfvlKvlWle~~iaiAvDQ~v-g~~t~PLT~yfFWPr~   44 (104)
T PRK02724          4 ADEGRFILKVLWLDDNVALAVDQIV-GKGTSPLTAYFFWPRN   44 (104)
T ss_pred             cccceEEEEEEEeccceeEEeeeec-CCCCCcCcceeecCCc
Confidence            4689999999999999999999999 9999999999999997


No 2  
>CHL00163 ycf65 putative ribosomal protein 3; Validated
Probab=99.87  E-value=8.7e-23  Score=149.81  Aligned_cols=39  Identities=36%  Similarity=0.657  Sum_probs=37.5

Q ss_pred             CCeEEEEEEeeeCceEEEeeeeecCCCcccceeeeecccC
Q 032883           91 KPRLVLKFIWMEKNIGLALDQSIPGAVAILLLSWMKIPVS  130 (131)
Q Consensus        91 ~~rfvLK~LWleknIgiAlDQvv~g~~t~PLT~YfFWPr~  130 (131)
                      ++||+||||||||||||||||++ |+|++|||+||||||+
T Consensus         1 m~kf~lKvlWl~~~iaiAvDq~v-~~~t~PlT~yfFWPr~   39 (99)
T CHL00163          1 MQKFTLKVLWLENNIGIAVDQIV-GNGTSPLTSYFFWPRT   39 (99)
T ss_pred             CCeEEEEEEEecCceEEEEeeee-CCCCccCcceeecCCc
Confidence            58999999999999999999999 7899999999999997


No 3  
>cd00732 CheW CheW, a small regulator protein, unique to the chemotaxis signalling in prokaryotes and archea. CheW interacts with the histidine kinase CheA, most likely with the related regulatory domain of CheA. CheW is proposed to form signalling arrays together with CheA and the methyl-accepting chemotaxis proteins (MCPs), which are involved in response modulation.
Probab=21.47  E-value=1.5e+02  Score=20.75  Aligned_cols=25  Identities=12%  Similarity=0.202  Sum_probs=17.5

Q ss_pred             EEEEEEeeeCceEEEeeeeecCCCcc
Q 032883           94 LVLKFIWMEKNIGLALDQSIPGAVAI  119 (131)
Q Consensus        94 fvLK~LWleknIgiAlDQvv~g~~t~  119 (131)
                      .++=+-+-+..+|+.||++. |-..+
T Consensus        72 ~vli~~~~~~~~gl~Vd~v~-~i~~~   96 (140)
T cd00732          72 RIIVVEVGDQVVGLLVDSVS-EVLRL   96 (140)
T ss_pred             EEEEEEECCEEEEEEEeeEe-eEEEE
Confidence            34445556788999999998 64443


No 4  
>PF14189 DUF4312:  Domain of unknown function (DUF4312)
Probab=20.72  E-value=41  Score=24.45  Aligned_cols=7  Identities=14%  Similarity=0.415  Sum_probs=4.0

Q ss_pred             eeecccC
Q 032883          124 WMKIPVS  130 (131)
Q Consensus       124 YfFWPr~  130 (131)
                      ||||||+
T Consensus        62 ~fF~PR~   68 (85)
T PF14189_consen   62 FFFFPRE   68 (85)
T ss_pred             eeecccc
Confidence            3566664


No 5  
>smart00141 PDGF Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family. Platelet-derived growth factor is a potent activator for cells of  mesenchymal origin. PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer. Members of the VEGF family are homologues of PDGF.
Probab=18.19  E-value=51  Score=23.30  Aligned_cols=8  Identities=13%  Similarity=0.268  Sum_probs=6.6

Q ss_pred             eeeeeccc
Q 032883          122 LSWMKIPV  129 (131)
Q Consensus       122 T~YfFWPr  129 (131)
                      ++|+|||.
T Consensus        20 ~~~~y~P~   27 (83)
T smart00141       20 TNFLFKPP   27 (83)
T ss_pred             cCcEEecC
Confidence            48999996


No 6  
>cd00135 PDGF Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family domain; PDGF is a potent activator for cells of mesenchymal origin; PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer; VEGF is a potent mitogen in embryonic and somatic angiogenesis with a unique specificity for vascular endothelial cells; VEGF forms homodimers and exists in 4 different isoforms; overall, the VEGF monomer resembles that of PDGF, but its N-terminal segment is helical rather than extended; the cysteine knot motif is a common feature of this domain
Probab=17.78  E-value=69  Score=22.48  Aligned_cols=8  Identities=13%  Similarity=-0.039  Sum_probs=6.9

Q ss_pred             eeeeeccc
Q 032883          122 LSWMKIPV  129 (131)
Q Consensus       122 T~YfFWPr  129 (131)
                      ++|+|||+
T Consensus        20 ~~~~y~P~   27 (86)
T cd00135          20 TNTIFKPP   27 (86)
T ss_pred             cCCEEECC
Confidence            68999996


No 7  
>cd00588 CheW_like CheW-like domain. CheW proteins are part of the chemotaxis signalling mechanism in bacteria. CheW interacts with the methyl accepting chemotaxis proteins (MCPs) and relays signals to CheY, which affects flageller rotation. This family includes CheW and other related proteins that are involved in chemotaxis. The CheW-like regulatory domain in the chemotaxis associated histidine kinase CheA binds to CheW, suggesting that these domains can interact with each other.
Probab=15.98  E-value=1.7e+02  Score=19.91  Aligned_cols=26  Identities=15%  Similarity=0.414  Sum_probs=17.7

Q ss_pred             eEEEEEEeeeCceEEEeeeeecCCCcc
Q 032883           93 RLVLKFIWMEKNIGLALDQSIPGAVAI  119 (131)
Q Consensus        93 rfvLK~LWleknIgiAlDQvv~g~~t~  119 (131)
                      ..++=+=+-+..+|+.||++. |-...
T Consensus        72 ~~vii~~~~~~~~gl~Vd~i~-~i~~~   97 (136)
T cd00588          72 TRIVVVEVGDRKVGLVVDSVL-GVLEV   97 (136)
T ss_pred             cEEEEEEECCEEEEEEECccc-eEEEE
Confidence            344444456788999999998 54433


No 8  
>PF09337 zf-H2C2:  His(2)-Cys(2) zinc finger;  InterPro: IPR015416 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents an H2C2-type zinc finger that binds to histone upstream activating sequence (UAS) elements found in histone gene promoters [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=15.90  E-value=39  Score=20.83  Aligned_cols=12  Identities=8%  Similarity=-0.000  Sum_probs=8.8

Q ss_pred             cccceeeeeccc
Q 032883          118 AILLLSWMKIPV  129 (131)
Q Consensus       118 t~PLT~YfFWPr  129 (131)
                      +.=|..-|+||+
T Consensus        12 ~~~i~~~y~W~g   23 (39)
T PF09337_consen   12 TAKISQRYHWPG   23 (39)
T ss_pred             HHHHHHhheecC
Confidence            345678899996


No 9  
>PRK09455 rseB anti-sigma E factor; Provisional
Probab=15.06  E-value=2.6e+02  Score=23.94  Aligned_cols=26  Identities=15%  Similarity=0.463  Sum_probs=22.4

Q ss_pred             eeeecCCCCeEEEEEEeeeCceEEEee
Q 032883           84 VSVKQLEKPRLVLKFIWMEKNIGLALD  110 (131)
Q Consensus        84 ~~v~~~~~~rfvLK~LWleknIgiAlD  110 (131)
                      +.+.|.+..||. ..||+|+.-|+-|=
T Consensus       145 i~~~PkD~~rY~-~~lwiD~et~llLk  170 (319)
T PRK09455        145 IRIVPKDGTRYS-YIVWIDEESKLPLR  170 (319)
T ss_pred             EEEEECCCCCcc-eEEEEEcCCCCEEe
Confidence            344889999999 99999999998876


No 10 
>PRK13994 potassium-transporting ATPase subunit C; Provisional
Probab=13.94  E-value=79  Score=26.57  Aligned_cols=16  Identities=13%  Similarity=-0.251  Sum_probs=11.4

Q ss_pred             CCCcccceeeeecccC
Q 032883          115 GAVAILLLSWMKIPVS  130 (131)
Q Consensus       115 g~~t~PLT~YfFWPr~  130 (131)
                      |.++-|-.+.|||||-
T Consensus        75 ~~~~~~~~~~YF~~RP   90 (222)
T PRK13994         75 GEETPEPDLKWFQPRP   90 (222)
T ss_pred             ccccCCCCCccccCCC
Confidence            4555455689999993


Done!