BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032884
(131 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P36809|VE6_HPV30 Protein E6 OS=Human papillomavirus type 30 GN=E6 PE=3 SV=1
Length = 153
Score = 29.6 bits (65), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 21/73 (28%)
Query: 39 KNYNYCIYDSDISTGMGVGAFLFLLASQVLIMLASRCFCCGKPLSPGGSRAWAVILFIIC 98
++YNY +Y GA L L + L L RC+ C +PL+P + + C
Sbjct: 80 RHYNYSLY----------GASLVALTKKELFDLLIRCYRCQQPLTPEEKQ-------LHC 122
Query: 99 WYV----RISSDW 107
Y RIS W
Sbjct: 123 EYKKRFHRISRTW 135
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.333 0.143 0.460
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,782,353
Number of Sequences: 539616
Number of extensions: 1531684
Number of successful extensions: 5523
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 5523
Number of HSP's gapped (non-prelim): 3
length of query: 131
length of database: 191,569,459
effective HSP length: 97
effective length of query: 34
effective length of database: 139,226,707
effective search space: 4733708038
effective search space used: 4733708038
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 55 (25.8 bits)