Query         032901
Match_columns 130
No_of_seqs    103 out of 200
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:20:58 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032901.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032901hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00186 ribosomal protein S26 100.0 5.9E-60 1.3E-64  348.9   7.8  105    1-105     1-107 (109)
  2 PF01283 Ribosomal_S26e:  Ribos 100.0 1.5E-60 3.3E-65  353.8   4.3  108    1-108     1-110 (113)
  3 PTZ00172 40S ribosomal protein 100.0 2.1E-59 4.5E-64  345.6   8.1  102    1-102     1-104 (108)
  4 PRK09335 30S ribosomal protein 100.0 1.3E-53 2.9E-58  309.0   6.9   92    1-96      1-94  (95)
  5 KOG1768 40s ribosomal protein  100.0 3.6E-51 7.9E-56  304.3   4.2  106    1-106     1-108 (115)
  6 COG4830 RPS26B Ribosomal prote 100.0 6.7E-49 1.4E-53  288.5   5.9   95    1-95      1-97  (108)
  7 PF02591 DUF164:  Putative zinc  58.2     5.5 0.00012   25.3   1.1   13   18-30     44-56  (56)
  8 PF07503 zf-HYPF:  HypF finger;  56.8     5.3 0.00011   24.2   0.7   13   15-27     16-28  (35)
  9 PF08209 Sgf11:  Sgf11 (transcr  56.3     6.1 0.00013   23.8   0.9   15   18-32      2-16  (33)
 10 TIGR01031 rpmF_bact ribosomal   51.4      12 0.00026   24.5   1.8   30    2-31      2-37  (55)
 11 COG1644 RPB10 DNA-directed RNA  50.7     7.3 0.00016   27.0   0.7   14   19-32      3-16  (63)
 12 PF01194 RNA_pol_N:  RNA polyme  50.0     3.3 7.2E-05   28.2  -1.0   14   19-32      3-16  (60)
 13 PRK04016 DNA-directed RNA poly  49.9     8.3 0.00018   26.4   0.9   14   19-32      3-16  (62)
 14 PF04726 Microvir_J:  Microviru  49.1     9.4  0.0002   21.9   0.9   15    1-15      1-15  (24)
 15 KOG2612 Predicted integral mem  48.7     6.8 0.00015   29.2   0.4   16   17-32     71-86  (103)
 16 COG1150 HdrC Heterodisulfide r  47.3     7.3 0.00016   31.9   0.4   48   20-76     38-89  (195)
 17 PLN00032 DNA-directed RNA poly  45.1      11 0.00024   26.6   0.9   14   19-32      3-16  (71)
 18 COG5112 UFD2 U1-like Zn-finger  43.2     7.6 0.00017   29.8  -0.1   31   47-79     31-65  (126)
 19 PF13119 DUF3973:  Domain of un  41.4      12 0.00026   24.0   0.6   11   69-79      1-12  (41)
 20 KOG3408 U1-like Zn-finger-cont  37.2      11 0.00023   29.4  -0.1   18   60-79     50-67  (129)
 21 COG1400 SEC65 Signal recogniti  35.1     9.6 0.00021   27.9  -0.6   23   27-51     20-44  (93)
 22 PF10122 Mu-like_Com:  Mu-like   33.4      22 0.00047   23.7   0.9   14   19-32      3-16  (51)
 23 COG5134 Uncharacterized conser  32.8      25 0.00053   30.1   1.4   44   20-75     42-85  (272)
 24 PRK12286 rpmF 50S ribosomal pr  32.6      29 0.00062   23.0   1.4   31    2-32      4-39  (57)
 25 COG4481 Uncharacterized protei  30.9      25 0.00055   24.0   0.9   15   16-30     30-44  (60)
 26 KOG3497 DNA-directed RNA polym  30.4      22 0.00048   24.8   0.6   14   19-32      3-16  (69)
 27 PF12838 Fer4_7:  4Fe-4S diclus  28.5      17 0.00036   22.1  -0.3   14   63-76     29-42  (52)
 28 PF03604 DNA_RNApol_7kD:  DNA d  27.5      23 0.00049   21.1   0.2   13   18-30     15-27  (32)
 29 PF10589 NADH_4Fe-4S:  NADH-ubi  27.0      20 0.00043   22.4  -0.1    9   24-32     14-22  (46)
 30 PF00037 Fer4:  4Fe-4S binding   25.6      23 0.00049   19.2  -0.0   12   21-32      6-17  (24)
 31 PF13717 zinc_ribbon_4:  zinc-r  24.8      42 0.00092   20.0   1.1   14   16-29     21-34  (36)
 32 PF06107 DUF951:  Bacterial pro  23.9      40 0.00087   22.8   0.9   13   18-30     29-41  (57)
 33 PF06639 BAP:  Basal layer anti  23.4      20 0.00043   25.6  -0.7   22   73-94      5-26  (75)
 34 PF13913 zf-C2HC_2:  zinc-finge  22.2      39 0.00084   18.6   0.5   12   20-31      2-13  (25)
 35 PF14832 Tautomerase_3:  Putati  21.7      60  0.0013   24.7   1.6   25   46-72     20-44  (136)
 36 PF08646 Rep_fac-A_C:  Replicat  21.6      64  0.0014   23.6   1.7   32    9-40     25-57  (146)
 37 PF04810 zf-Sec23_Sec24:  Sec23  21.3      41 0.00089   20.3   0.5   13   20-32      2-14  (40)
 38 PRK03954 ribonuclease P protei  21.3      75  0.0016   24.1   2.0   21   15-41     89-109 (121)
 39 COG1326 Uncharacterized archae  21.2      50  0.0011   27.4   1.1   18   15-32     25-42  (201)
 40 TIGR02174 CXXU_selWTH selT/sel  21.2      43 0.00092   22.4   0.6   14   67-80      1-14  (72)
 41 PF10238 Eapp_C:  E2F-associate  21.0      73  0.0016   24.6   1.9   11   20-30    109-119 (136)
 42 PF04161 Arv1:  Arv1-like famil  20.6      52  0.0011   26.1   1.1   19   14-32     18-36  (208)
 43 PF00374 NiFeSe_Hases:  Nickel-  20.5      23  0.0005   32.1  -1.0    8   71-78    500-507 (507)
 44 PF13248 zf-ribbon_3:  zinc-rib  20.3      41 0.00089   18.5   0.3   13   20-32      2-14  (26)
 45 PF14424 Toxin-deaminase:  The   20.0      64  0.0014   24.3   1.4   31   44-76     77-112 (133)

No 1  
>PLN00186 ribosomal protein S26; Provisional
Probab=100.00  E-value=5.9e-60  Score=348.94  Aligned_cols=105  Identities=90%  Similarity=1.439  Sum_probs=102.2

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      ||+|||||||+|+|+|||++|+|+|||+||||  |||+|+|+||||++++|||+|||||++|.|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~vy~~y~lPKly~K~~YCVSCAIH   80 (109)
T PLN00186          1 MTKKRRNGGRNKHGRGHVKRIRCSNCGKCVPKDKAIKRFLVRNIVEQAALRDVQEACVYDGYTLPKLYAKVQYCISCAIH   80 (109)
T ss_pred             CCcccccCCCCCCCCCCCcceeeCCCcccccccceEEEEecccCccHHHHHHHHhhhcccccccchhhhceEEEEeehhc
Confidence            99999999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             cceeccccccccccCCCCCCCcCCCCC
Q 032901           79 SHVVRVRSRTNRRIREPPQRFRRRDDV  105 (130)
Q Consensus        79 skVVRvRS~e~RK~r~pp~~~~~~~~~  105 (130)
                      ++||||||+|+||+|+||++|++.++.
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~~~~  107 (109)
T PLN00186         81 SRVVRVRSRENRRIREPPPRFRRRKDD  107 (109)
T ss_pred             cceeecCChHHccccCCCccccccccC
Confidence            999999999999999999999885543


No 2  
>PF01283 Ribosomal_S26e:  Ribosomal protein S26e;  InterPro: IPR000892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. One of these families, the S26E family, includes mammalian S26 []; Octopus S26 []; Drosophila S26 (DS31) []; plant cytoplasmic S26; and fungal S26 []. These proteins have 114 to 127 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_a 3U5C_a 2XZM_5 2XZN_5.
Probab=100.00  E-value=1.5e-60  Score=353.76  Aligned_cols=108  Identities=68%  Similarity=1.169  Sum_probs=71.0

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      ||+|||||||+|||+||+++|+|+|||+||||  |||+|+|+||||++++|||+|||||++|+|||||+|+|||||||||
T Consensus         1 M~~KRrN~Gr~KkgrGhv~~V~C~nCgr~vPKDKAIkrf~i~niVeaaa~rdi~~a~v~~~y~lPKlyvK~~YCvSCAIH   80 (113)
T PF01283_consen    1 MTKKRRNNGRSKKGRGHVQPVRCDNCGRCVPKDKAIKRFVIRNIVEAAAVRDISEASVYDAYVLPKLYVKLYYCVSCAIH   80 (113)
T ss_dssp             -----TTTTSS-SSSS---EEE-TTTB-EEECCCSEEEEEEEESS-CCCHHHHHHCB-SSS--S-EEEEEEEE-CHHHHH
T ss_pred             CCcccccCCCCCCCCCCCcCEeeCcccccCcCCceEEEEEccCCccHHHHHHHhhcceeeecccccceeEEEEeeeeeee
Confidence            99999999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             cceeccccccccccCCCCCCCcCCCCCCCC
Q 032901           79 SHVVRVRSRTNRRIREPPQRFRRRDDVPKA  108 (130)
Q Consensus        79 skVVRvRS~e~RK~r~pp~~~~~~~~~~~~  108 (130)
                      ++|||+||+|+||+|+||++|++.++..++
T Consensus        81 ~~IVr~Rs~e~RK~r~~p~~~~~~~~~~~~  110 (113)
T PF01283_consen   81 SKIVRVRSREERKDRTPPPRFRPRKQGQKP  110 (113)
T ss_dssp             TTSS----TCCCC--S--------------
T ss_pred             ccccccCChHHccccCCCCcCCcccccccc
Confidence            999999999999999999999997655543


No 3  
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=100.00  E-value=2.1e-59  Score=345.61  Aligned_cols=102  Identities=74%  Similarity=1.226  Sum_probs=99.9

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      ||+|||||||+|+|+|||++|+|+|||+||||  |||+|+|+||||+++++||+|||+|++|+|||||+|+|||||||||
T Consensus         1 M~kKRrN~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~irniVe~aa~rDl~~a~v~~~y~lPKly~k~~YCVSCAIH   80 (108)
T PTZ00172          1 MTSKRRNNGRSKHGRGHVKPVRCSNCGRCVPKDKAIKRFVVRNIVDAASVRDIAEASVYYGYPLPKLYMKQQYCVSCAIH   80 (108)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCccccccccceEEEEeccCCccHHHHHHHHHhhchhccccccceeeeEEeeehhhc
Confidence            99999999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             cceeccccccccccCCCCCCCcCC
Q 032901           79 SHVVRVRSRTNRRIREPPQRFRRR  102 (130)
Q Consensus        79 skVVRvRS~e~RK~r~pp~~~~~~  102 (130)
                      ++||||||+|+||+|+||+++...
T Consensus        81 ~~iVRvRs~e~Rk~r~pp~r~~~~  104 (108)
T PTZ00172         81 SRVVRVRSREDRKIRTPPKRPFRP  104 (108)
T ss_pred             CCeeecCChHHccccCCCCCCCCC
Confidence            999999999999999999887653


No 4  
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=100.00  E-value=1.3e-53  Score=308.97  Aligned_cols=92  Identities=28%  Similarity=0.644  Sum_probs=90.1

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      ||+||+||||+|+|+||+++|+|+|||+||||  |||+|+|+||||+++++||+||++|    |||||+|+|||||||||
T Consensus         1 M~kKRrn~GR~K~~rGhv~~V~C~nCgr~vPKDKAIkrf~i~n~Ve~a~~rdl~~a~~~----lpk~~~k~~YCvSCAiH   76 (95)
T PRK09335          1 MPKKRENRGRRKGDKGHVGYVQCDNCGRRVPRDKAVCVTKMYSPVDPQLAKELEKKGAI----IARYPVTKCYCVNCAVH   76 (95)
T ss_pred             CCcccccCCCCCCCCCCCccEEeCCCCCcCcCCceEEEEEecCCCCHHHHHHHHhCcee----eeeeeeeeEEechhhhh
Confidence            99999999999999999999999999999999  9999999999999999999999988    99999999999999999


Q ss_pred             cceeccccccccccCCCC
Q 032901           79 SHVVRVRSRTNRRIREPP   96 (130)
Q Consensus        79 skVVRvRS~e~RK~r~pp   96 (130)
                      ++|||+||+|+||+|+|.
T Consensus        77 ~~IVrvRs~e~Rk~r~~~   94 (95)
T PRK09335         77 LGIIKIRPEEERKKKAPL   94 (95)
T ss_pred             ccccccCChHHcccccCC
Confidence            999999999999999863


No 5  
>KOG1768 consensus 40s ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=3.6e-51  Score=304.29  Aligned_cols=106  Identities=71%  Similarity=1.187  Sum_probs=102.0

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      |++||+|+|++|+|+||+.+|+|+||++||||  |||+|+|+||||++++|||+|||+|++|+|||||+|||||||||||
T Consensus         1 m~~kr~~~gr~k~~~g~v~~i~c~~c~~~~~kdKaIk~f~i~niVEaaavrdiseasv~d~y~~pKly~Klhycvscaih   80 (115)
T KOG1768|consen    1 MTKKRRNAGRNKKGRGHVIPIRCTNCGRCMPKDKAIKRFVIRNIVEAAAVRDISEASVFDAYVLPKLYVKLHYCVSCAIH   80 (115)
T ss_pred             CCcccccCCCCCCCCcceeeeeeccccccchHHHHHHHHHHHHHHHHHHhhhhhhheeccccccccccceeeeeEeeeee
Confidence            99999999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             cceeccccccccccCCCCCCCcCCCCCC
Q 032901           79 SHVVRVRSRTNRRIREPPQRFRRRDDVP  106 (130)
Q Consensus        79 skVVRvRS~e~RK~r~pp~~~~~~~~~~  106 (130)
                      ++|||+||.|.||+|+||++|.+.....
T Consensus        81 skVvR~rS~e~rrir~pp~rf~~~~~~~  108 (115)
T KOG1768|consen   81 SKVVRVRSREARRIRTPPPRFSPRAPSL  108 (115)
T ss_pred             eeeeccchhhhhcccCCCcccCcccccc
Confidence            9999999999999999999887744333


No 6  
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=6.7e-49  Score=288.53  Aligned_cols=95  Identities=64%  Similarity=1.125  Sum_probs=94.6

Q ss_pred             CCcccccCCCCCCCCCccccEeccCccccccc--ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeecee
Q 032901            1 MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPK--AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIH   78 (130)
Q Consensus         1 M~kKRrNnGR~KkgrGhv~~V~C~NCgr~vPK--AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCAIH   78 (130)
                      |||||+||||+|+|+||+.+|+|+|||..|||  |||+|.|+|+||+++++||+++++|+.|.+||+|.|++||||||||
T Consensus         1 mpkkR~N~GR~K~~rGhv~~v~CdnCg~~vPkdKAikr~~i~s~Ve~a~~rdL~~asIy~~y~vpk~~~k~qyCVsCAih   80 (108)
T COG4830           1 MPKKRRNRGRNKKGRGHVKYVRCDNCGKAVPKDKAIKRTAIRSPVEAAAARDLSEASIYSEYAVPKTYNKLQYCVSCAIH   80 (108)
T ss_pred             CcchhhhcCCCCCCCCCccceeeccccccCCccceeeEeeccCcccHHHHHHHhhceeeeeeeccccccceeeeeeeeee
Confidence            99999999999999999999999999999999  9999999999999999999999999999999999999999999999


Q ss_pred             cceeccccccccccCCC
Q 032901           79 SHVVRVRSRTNRRIREP   95 (130)
Q Consensus        79 skVVRvRS~e~RK~r~p   95 (130)
                      ++||||||+|+||+++|
T Consensus        81 ~~IvrVRSre~RK~r~p   97 (108)
T COG4830          81 ARIVRVRSREERKIRAP   97 (108)
T ss_pred             eeEEEEecchhhhhcCC
Confidence            99999999999999998


No 7  
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=58.16  E-value=5.5  Score=25.35  Aligned_cols=13  Identities=31%  Similarity=0.848  Sum_probs=10.5

Q ss_pred             cccEeccCccccc
Q 032901           18 VKFIRCSNCGKCC   30 (130)
Q Consensus        18 v~~V~C~NCgr~v   30 (130)
                      ...+.|+||||.+
T Consensus        44 ~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   44 DEIVFCPNCGRIL   56 (56)
T ss_pred             CCeEECcCCCccC
Confidence            4678999999863


No 8  
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=56.83  E-value=5.3  Score=24.23  Aligned_cols=13  Identities=62%  Similarity=1.321  Sum_probs=8.7

Q ss_pred             CCccccEeccCcc
Q 032901           15 RGHVKFIRCSNCG   27 (130)
Q Consensus        15 rGhv~~V~C~NCg   27 (130)
                      |=|-++|-|++||
T Consensus        16 R~~~~~isC~~CG   28 (35)
T PF07503_consen   16 RFHYQFISCTNCG   28 (35)
T ss_dssp             TTT-TT--BTTCC
T ss_pred             cccCcCccCCCCC
Confidence            4688999999999


No 9  
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=56.26  E-value=6.1  Score=23.82  Aligned_cols=15  Identities=27%  Similarity=0.895  Sum_probs=10.3

Q ss_pred             cccEeccCccccccc
Q 032901           18 VKFIRCSNCGKCCPK   32 (130)
Q Consensus        18 v~~V~C~NCgr~vPK   32 (130)
                      ...+.|.||+|-|..
T Consensus         2 ~~~~~C~nC~R~v~a   16 (33)
T PF08209_consen    2 SPYVECPNCGRPVAA   16 (33)
T ss_dssp             S-EEE-TTTSSEEEG
T ss_pred             CCeEECCCCcCCcch
Confidence            457899999997754


No 10 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=51.39  E-value=12  Score=24.51  Aligned_cols=30  Identities=23%  Similarity=0.574  Sum_probs=19.8

Q ss_pred             CcccccCCCCCCCCCc------cccEeccCcccccc
Q 032901            2 TFKRRNGGRNKHGRGH------VKFIRCSNCGKCCP   31 (130)
Q Consensus         2 ~kKRrNnGR~KkgrGh------v~~V~C~NCgr~vP   31 (130)
                      ||+|-+..|..+=|.|      ...+.|.+||...-
T Consensus         2 PKrk~Sksr~~~RRah~~kl~~p~l~~C~~cG~~~~   37 (55)
T TIGR01031         2 PKRKTSKSRKRKRRSHDAKLTAPTLVVCPNCGEFKL   37 (55)
T ss_pred             CCCcCCcccccchhcCcccccCCcceECCCCCCccc
Confidence            5566665555555555      45788999997543


No 11 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=50.69  E-value=7.3  Score=26.96  Aligned_cols=14  Identities=36%  Similarity=0.731  Sum_probs=12.2

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      -||||-+||+.+--
T Consensus         3 iPiRCFsCGkvi~~   16 (63)
T COG1644           3 IPVRCFSCGKVIGH   16 (63)
T ss_pred             CceEeecCCCCHHH
Confidence            48999999998876


No 12 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=50.04  E-value=3.3  Score=28.15  Aligned_cols=14  Identities=36%  Similarity=0.726  Sum_probs=10.8

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      -||||-.||+.+-.
T Consensus         3 iPVRCFTCGkvi~~   16 (60)
T PF01194_consen    3 IPVRCFTCGKVIGN   16 (60)
T ss_dssp             -SSS-STTTSBTCG
T ss_pred             CceecCCCCCChhH
Confidence            38999999999876


No 13 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=49.92  E-value=8.3  Score=26.43  Aligned_cols=14  Identities=36%  Similarity=0.781  Sum_probs=12.3

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      -||+|..||+.+--
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            48999999998865


No 14 
>PF04726 Microvir_J:  Microvirus J protein;  InterPro: IPR006815 This small protein is involved in DNA packaging, interacting with DNA via its hydrophobic C terminus. In bacteriophage phi-X174, J is present in 60 copies, and forms an S-shaped polypeptide chain without any secondary structure. It is thought to interact with DNA through simple charge interactions [].; GO: 0003677 DNA binding, 0019073 viral DNA genome packaging, 0019028 viral capsid; PDB: 1M06_J 1GFF_3 1RB8_J 2BPA_3.
Probab=49.15  E-value=9.4  Score=21.85  Aligned_cols=15  Identities=53%  Similarity=0.851  Sum_probs=7.8

Q ss_pred             CCcccccCCCCCCCC
Q 032901            1 MTFKRRNGGRNKHGR   15 (130)
Q Consensus         1 M~kKRrNnGR~Kkgr   15 (130)
                      |-++||+.|++|+.|
T Consensus         1 ~k~~rrs~~~~kgar   15 (24)
T PF04726_consen    1 MKSKRRSGGKRKGAR   15 (24)
T ss_dssp             --GGGS---SSSSS-
T ss_pred             CcccccCCCccCceE
Confidence            567899999999875


No 15 
>KOG2612 consensus Predicted integral membrane protein [Function unknown]
Probab=48.66  E-value=6.8  Score=29.18  Aligned_cols=16  Identities=19%  Similarity=0.395  Sum_probs=13.0

Q ss_pred             ccccEeccCccccccc
Q 032901           17 HVKFIRCSNCGKCCPK   32 (130)
Q Consensus        17 hv~~V~C~NCgr~vPK   32 (130)
                      ..+.++|.||+|.|--
T Consensus        71 k~~~~hCeNC~RdVaA   86 (103)
T KOG2612|consen   71 KPMDCHCENCDRDVAA   86 (103)
T ss_pred             CCccccCCCCccHHHH
Confidence            4568999999998754


No 16 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=47.29  E-value=7.3  Score=31.91  Aligned_cols=48  Identities=23%  Similarity=0.546  Sum_probs=29.8

Q ss_pred             cEeccCccccccc----ceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeeec
Q 032901           20 FIRCSNCGKCCPK----AIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCA   76 (130)
Q Consensus        20 ~V~C~NCgr~vPK----AIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSCA   76 (130)
                      .-.|-|||-|.--    -.-.|..|-||.-+..-|..  .++...       .+++|++|-
T Consensus        38 l~~C~QCG~CT~sCPs~r~t~y~pR~ii~~~~~g~~d--~il~~~-------~lW~C~tCy   89 (195)
T COG1150          38 LEGCYQCGTCTGSCPSGRFTDYSPRKIIRKARLGLVD--LILSSE-------SLWACVTCY   89 (195)
T ss_pred             HhHhhccCcccCCCCCcccCCCCHHHHHHHHHcccHH--HHhcCC-------cceeeeech
Confidence            3448888888655    22445556688877765554  333222       378999983


No 17 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=45.14  E-value=11  Score=26.57  Aligned_cols=14  Identities=36%  Similarity=0.726  Sum_probs=12.0

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      -||||-.||+.+--
T Consensus         3 iPVRCFTCGkvig~   16 (71)
T PLN00032          3 IPVRCFTCGKVIGN   16 (71)
T ss_pred             CceeecCCCCCcHH
Confidence            48999999998865


No 18 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=43.15  E-value=7.6  Score=29.83  Aligned_cols=31  Identities=23%  Similarity=0.358  Sum_probs=19.2

Q ss_pred             HHHhHHHhcccc----ccccceeeeeeeeeeeeceec
Q 032901           47 AVRDVQEACVYD----GYTLPKLYAKMQYCVSCAIHS   79 (130)
Q Consensus        47 avRDi~eAsv~~----~y~lPKlyvKl~YCVSCAIHs   79 (130)
                      +-.||++.--++    .-.||-  .-.||||.||-|.
T Consensus        31 i~nDls~~Es~~Klp~Dp~lPG--lGqhYCieCaryf   65 (126)
T COG5112          31 IKNDLSTKESQKKLPYDPELPG--LGQHYCIECARYF   65 (126)
T ss_pred             HHHhcchhhhhccCCCCCCCCC--CceeeeehhHHHH
Confidence            346776544443    223443  4589999999775


No 19 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=41.37  E-value=12  Score=23.98  Aligned_cols=11  Identities=55%  Similarity=1.428  Sum_probs=8.1

Q ss_pred             eeeeeee-ceec
Q 032901           69 MQYCVSC-AIHS   79 (130)
Q Consensus        69 l~YCVSC-AIHs   79 (130)
                      .+|||+| -||.
T Consensus         1 MyYCi~Cs~~h~   12 (41)
T PF13119_consen    1 MYYCINCSEIHH   12 (41)
T ss_pred             CEEEEEhHHhHH
Confidence            3799999 4653


No 20 
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=37.21  E-value=11  Score=29.35  Aligned_cols=18  Identities=33%  Similarity=0.598  Sum_probs=13.1

Q ss_pred             cccceeeeeeeeeeeeceec
Q 032901           60 YTLPKLYAKMQYCVSCAIHS   79 (130)
Q Consensus        60 y~lPKlyvKl~YCVSCAIHs   79 (130)
                      +.||-  .-++||+.||-|.
T Consensus        50 ~dlPG--~GqfyCi~CaRyF   67 (129)
T KOG3408|consen   50 PDLPG--GGQFYCIECARYF   67 (129)
T ss_pred             CCCCC--Cceeehhhhhhhh
Confidence            44553  4589999999775


No 21 
>COG1400 SEC65 Signal recognition particle 19 kDa protein [Intracellular trafficking and secretion]
Probab=35.09  E-value=9.6  Score=27.88  Aligned_cols=23  Identities=30%  Similarity=0.589  Sum_probs=18.4

Q ss_pred             cccccc--ceeEeeecccchhHHHHhH
Q 032901           27 GKCCPK--AIKRFLVRNIVEQAAVRDV   51 (130)
Q Consensus        27 gr~vPK--AIKrf~irNiVEaaavRDi   51 (130)
                      ||+|||  ||..+....|+|+  +++|
T Consensus        20 GRrvpk~laV~~P~~~ei~~a--~~~L   44 (93)
T COG1400          20 GRRVPKELAVENPSLEEIAEA--LREL   44 (93)
T ss_pred             ccccchhhcccCCCHHHHHHH--HHHc
Confidence            599999  9998888888774  5555


No 22 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=33.41  E-value=22  Score=23.66  Aligned_cols=14  Identities=50%  Similarity=0.873  Sum_probs=12.2

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      +-|||.+|++++-+
T Consensus         3 ~eiRC~~CnklLa~   16 (51)
T PF10122_consen    3 KEIRCGHCNKLLAK   16 (51)
T ss_pred             cceeccchhHHHhh
Confidence            56899999998877


No 23 
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=32.82  E-value=25  Score=30.06  Aligned_cols=44  Identities=32%  Similarity=0.493  Sum_probs=26.4

Q ss_pred             cEeccCcccccccceeEeeecccchhHHHHhHHHhccccccccceeeeeeeeeeee
Q 032901           20 FIRCSNCGKCCPKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSC   75 (130)
Q Consensus        20 ~V~C~NCgr~vPKAIKrf~irNiVEaaavRDi~eAsv~~~y~lPKlyvKl~YCVSC   75 (130)
                      +|+|-||+-.+|| =++|        .++++|...--|.+.   |+|-=..-|--|
T Consensus        42 ~~RCL~C~~YI~K-~~rf--------NavkE~~~dK~y~~~---kiYRf~I~C~~C   85 (272)
T COG5134          42 PVRCLNCENYIQK-GTRF--------NAVKEEIGDKSYYTT---KIYRFSIKCHLC   85 (272)
T ss_pred             ceeecchhhhhhc-ccch--------hHHHHHhccccccee---EEEEEEEEccCC
Confidence            7999999999999 3334        246666443334333   445444444444


No 24 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=32.64  E-value=29  Score=22.97  Aligned_cols=31  Identities=23%  Similarity=0.538  Sum_probs=18.9

Q ss_pred             CcccccCCCCCCCCCc-----cccEeccCccccccc
Q 032901            2 TFKRRNGGRNKHGRGH-----VKFIRCSNCGKCCPK   32 (130)
Q Consensus         2 ~kKRrNnGR~KkgrGh-----v~~V~C~NCgr~vPK   32 (130)
                      ||+|-+..|..+=|.|     ...+.|.+||-....
T Consensus         4 PKrk~S~srr~~RRsh~~l~~~~l~~C~~CG~~~~~   39 (57)
T PRK12286          4 PKRKTSKSRKRKRRAHFKLKAPGLVECPNCGEPKLP   39 (57)
T ss_pred             CcCcCChhhcchhcccccccCCcceECCCCCCccCC
Confidence            5555555554444555     336779999986554


No 25 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.93  E-value=25  Score=24.04  Aligned_cols=15  Identities=40%  Similarity=0.855  Sum_probs=10.8

Q ss_pred             CccccEeccCccccc
Q 032901           16 GHVKFIRCSNCGKCC   30 (130)
Q Consensus        16 Ghv~~V~C~NCgr~v   30 (130)
                      |-.-.|.|+|||+.|
T Consensus        30 GaDIkikC~nC~h~v   44 (60)
T COG4481          30 GADIKIKCENCGHSV   44 (60)
T ss_pred             cCcEEEEecCCCcEE
Confidence            334468999999953


No 26 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=30.40  E-value=22  Score=24.84  Aligned_cols=14  Identities=43%  Similarity=0.740  Sum_probs=11.7

Q ss_pred             ccEeccCccccccc
Q 032901           19 KFIRCSNCGKCCPK   32 (130)
Q Consensus        19 ~~V~C~NCgr~vPK   32 (130)
                      -||+|..||..+-.
T Consensus         3 iPiRCFtCGKvig~   16 (69)
T KOG3497|consen    3 IPIRCFTCGKVIGD   16 (69)
T ss_pred             eeeEeeeccccccc
Confidence            38999999998765


No 27 
>PF12838 Fer4_7:  4Fe-4S dicluster domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3CF4_A 1K0T_A 2VKR_C 1JB0_C 3PCQ_C.
Probab=28.49  E-value=17  Score=22.12  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=6.2

Q ss_pred             ceeeeeeeeeeeec
Q 032901           63 PKLYAKMQYCVSCA   76 (130)
Q Consensus        63 PKlyvKl~YCVSCA   76 (130)
                      +.+.+...+|+.|.
T Consensus        29 ~~~~~~~~~C~~C~   42 (52)
T PF12838_consen   29 PKMVIDPDKCTGCG   42 (52)
T ss_dssp             TTSEETGGG----S
T ss_pred             eEEEEechhCcCcC
Confidence            44566677788774


No 28 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=27.46  E-value=23  Score=21.09  Aligned_cols=13  Identities=38%  Similarity=0.777  Sum_probs=9.3

Q ss_pred             cccEeccCccccc
Q 032901           18 VKFIRCSNCGKCC   30 (130)
Q Consensus        18 v~~V~C~NCgr~v   30 (130)
                      ..+|+|.+||--+
T Consensus        15 ~~~irC~~CG~RI   27 (32)
T PF03604_consen   15 GDPIRCPECGHRI   27 (32)
T ss_dssp             SSTSSBSSSS-SE
T ss_pred             CCcEECCcCCCeE
Confidence            3579999999643


No 29 
>PF10589 NADH_4Fe-4S:  NADH-ubiquinone oxidoreductase-F iron-sulfur binding region;  InterPro: IPR019575  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the F subunit of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2.  This entry represents the iron-sulphur binding domain of the F subunit.; GO: 0055114 oxidation-reduction process; PDB: 3IAS_S 2FUG_A 3I9V_A 3M9S_1 3IAM_A 2YBB_1.
Probab=27.03  E-value=20  Score=22.44  Aligned_cols=9  Identities=56%  Similarity=1.413  Sum_probs=4.2

Q ss_pred             cCccccccc
Q 032901           24 SNCGKCCPK   32 (130)
Q Consensus        24 ~NCgr~vPK   32 (130)
                      .+||+|+|=
T Consensus        14 ESCGkC~PC   22 (46)
T PF10589_consen   14 ESCGKCTPC   22 (46)
T ss_dssp             H--S--HHH
T ss_pred             cCCCCCCCc
Confidence            589999997


No 30 
>PF00037 Fer4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1DUR_A 1H98_A 1BD6_A 1BQX_A 1BWE_A 1BC6_A 3BK7_A 1FCA_A 1FDN_A 2FDN_A ....
Probab=25.56  E-value=23  Score=19.18  Aligned_cols=12  Identities=33%  Similarity=1.121  Sum_probs=7.4

Q ss_pred             EeccCccccccc
Q 032901           21 IRCSNCGKCCPK   32 (130)
Q Consensus        21 V~C~NCgr~vPK   32 (130)
                      -.|.+||.|+.-
T Consensus         6 ~~C~~Cg~C~~~   17 (24)
T PF00037_consen    6 DKCIGCGRCVEA   17 (24)
T ss_dssp             TTSSS-THHHHH
T ss_pred             HHCCCcchhhhh
Confidence            358888887643


No 31 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=24.77  E-value=42  Score=19.96  Aligned_cols=14  Identities=36%  Similarity=0.859  Sum_probs=10.7

Q ss_pred             CccccEeccCcccc
Q 032901           16 GHVKFIRCSNCGKC   29 (130)
Q Consensus        16 Ghv~~V~C~NCgr~   29 (130)
                      ++...|+|++||..
T Consensus        21 ~~g~~v~C~~C~~~   34 (36)
T PF13717_consen   21 PKGRKVRCSKCGHV   34 (36)
T ss_pred             CCCcEEECCCCCCE
Confidence            45568999999864


No 32 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=23.91  E-value=40  Score=22.77  Aligned_cols=13  Identities=31%  Similarity=0.654  Sum_probs=9.9

Q ss_pred             cccEeccCccccc
Q 032901           18 VKFIRCSNCGKCC   30 (130)
Q Consensus        18 v~~V~C~NCgr~v   30 (130)
                      .-.+.|++||+.|
T Consensus        29 DikikC~gCg~~i   41 (57)
T PF06107_consen   29 DIKIKCLGCGRQI   41 (57)
T ss_pred             cEEEEECCCCCEE
Confidence            3468899999943


No 33 
>PF06639 BAP:  Basal layer antifungal peptide (BAP);  InterPro: IPR009540 This family consists of several basal layer antifungal peptide (BAP) sequences specific to Zea mays (Maize). The BAP2 peptide exhibits potent broad-range activity against a range of filamentous fungi, including several plant pathogens [].
Probab=23.39  E-value=20  Score=25.57  Aligned_cols=22  Identities=23%  Similarity=0.610  Sum_probs=17.6

Q ss_pred             eeeceecceeccccccccccCC
Q 032901           73 VSCAIHSHVVRVRSRTNRRIRE   94 (130)
Q Consensus        73 VSCAIHskVVRvRS~e~RK~r~   94 (130)
                      -||.||++|++-+-+|+-.-+.
T Consensus         5 AS~V~hA~ii~Gqtke~~nt~s   26 (75)
T PF06639_consen    5 ASCVIHAHIISGQTKEDSNTGS   26 (75)
T ss_pred             hhhHhhHHhhcCceeeccCCCc
Confidence            4899999999988888755443


No 34 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=22.21  E-value=39  Score=18.62  Aligned_cols=12  Identities=25%  Similarity=0.822  Sum_probs=9.3

Q ss_pred             cEeccCcccccc
Q 032901           20 FIRCSNCGKCCP   31 (130)
Q Consensus        20 ~V~C~NCgr~vP   31 (130)
                      .+.|.+|||-.-
T Consensus         2 l~~C~~CgR~F~   13 (25)
T PF13913_consen    2 LVPCPICGRKFN   13 (25)
T ss_pred             CCcCCCCCCEEC
Confidence            578999998653


No 35 
>PF14832 Tautomerase_3:  Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A.
Probab=21.69  E-value=60  Score=24.67  Aligned_cols=25  Identities=20%  Similarity=0.610  Sum_probs=17.3

Q ss_pred             HHHHhHHHhccccccccceeeeeeeee
Q 032901           46 AAVRDVQEACVYDGYTLPKLYAKMQYC   72 (130)
Q Consensus        46 aavRDi~eAsv~~~y~lPKlyvKl~YC   72 (130)
                      +++++|.+  +|.++-||.+||-..+.
T Consensus        20 ~LA~~IT~--~y~~~glP~FyV~V~F~   44 (136)
T PF14832_consen   20 ALAEAITD--IYTSIGLPAFYVNVRFI   44 (136)
T ss_dssp             HHHHHHHH--HHHHTTTTGGG-EEEEE
T ss_pred             HHHHHHHH--HHhCCCCCCEEEEEEEE
Confidence            44555544  67777899999988775


No 36 
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=21.57  E-value=64  Score=23.57  Aligned_cols=32  Identities=22%  Similarity=0.325  Sum_probs=20.1

Q ss_pred             CCCCCCCCc-cccEeccCcccccccceeEeeec
Q 032901            9 GRNKHGRGH-VKFIRCSNCGKCCPKAIKRFLVR   40 (130)
Q Consensus         9 GR~KkgrGh-v~~V~C~NCgr~vPKAIKrf~ir   40 (130)
                      .++||-.-. ...-+|.+|+..++....||.+.
T Consensus        25 ~C~kKv~~~~~~~y~C~~C~~~~~~~~~ry~l~   57 (146)
T PF08646_consen   25 KCNKKVTENGDGSYRCEKCNKTVENPKYRYRLS   57 (146)
T ss_dssp             TTS-B-EEETTTEEEETTTTEEESS-EEEEEEE
T ss_pred             cCCCEeecCCCcEEECCCCCCcCCCeeEEEEEE
Confidence            455653322 23579999999987766777766


No 37 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=21.29  E-value=41  Score=20.27  Aligned_cols=13  Identities=23%  Similarity=0.570  Sum_probs=6.6

Q ss_pred             cEeccCccccccc
Q 032901           20 FIRCSNCGKCCPK   32 (130)
Q Consensus        20 ~V~C~NCgr~vPK   32 (130)
                      +++|.+|+..+-.
T Consensus         2 p~rC~~C~aylNp   14 (40)
T PF04810_consen    2 PVRCRRCRAYLNP   14 (40)
T ss_dssp             S-B-TTT--BS-T
T ss_pred             ccccCCCCCEECC
Confidence            7899999987765


No 38 
>PRK03954 ribonuclease P protein component 4; Validated
Probab=21.29  E-value=75  Score=24.06  Aligned_cols=21  Identities=38%  Similarity=0.732  Sum_probs=15.6

Q ss_pred             CCccccEeccCcccccccceeEeeecc
Q 032901           15 RGHVKFIRCSNCGKCCPKAIKRFLVRN   41 (130)
Q Consensus        15 rGhv~~V~C~NCgr~vPKAIKrf~irN   41 (130)
                      .||+ .|.|.+||.     +++|-+..
T Consensus        89 ~~~v-vitCl~CG~-----~kR~P~~~  109 (121)
T PRK03954         89 MPHV-VITCLECGH-----IMRYPYLR  109 (121)
T ss_pred             cceE-EEECccCCC-----EEeeccch
Confidence            3676 888999997     67776543


No 39 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=21.22  E-value=50  Score=27.37  Aligned_cols=18  Identities=39%  Similarity=1.034  Sum_probs=14.1

Q ss_pred             CCccccEeccCccccccc
Q 032901           15 RGHVKFIRCSNCGKCCPK   32 (130)
Q Consensus        15 rGhv~~V~C~NCgr~vPK   32 (130)
                      +|....++|.|||-.-|-
T Consensus        25 ~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326          25 RGREPLVRCEECGTVHPA   42 (201)
T ss_pred             cCCceEEEccCCCcEeec
Confidence            456689999999997643


No 40 
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=21.22  E-value=43  Score=22.38  Aligned_cols=14  Identities=29%  Similarity=0.871  Sum_probs=9.8

Q ss_pred             eeeeeeeeeceecc
Q 032901           67 AKMQYCVSCAIHSH   80 (130)
Q Consensus        67 vKl~YCVSCAIHsk   80 (130)
                      |...||.+|-...+
T Consensus         1 V~IeyC~~C~y~~R   14 (72)
T TIGR02174         1 VEIEYCGSCGYKPR   14 (72)
T ss_pred             CEEEECCCCCChHH
Confidence            45789999974433


No 41 
>PF10238 Eapp_C:  E2F-associated phosphoprotein;  InterPro: IPR019370 This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis []. 
Probab=20.97  E-value=73  Score=24.55  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=9.1

Q ss_pred             cEeccCccccc
Q 032901           20 FIRCSNCGKCC   30 (130)
Q Consensus        20 ~V~C~NCgr~v   30 (130)
                      ||.|+.|+--|
T Consensus       109 PV~Cs~C~TeV  119 (136)
T PF10238_consen  109 PVKCSECSTEV  119 (136)
T ss_pred             ceecccCCCEE
Confidence            89999998644


No 42 
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=20.62  E-value=52  Score=26.08  Aligned_cols=19  Identities=37%  Similarity=1.003  Sum_probs=16.6

Q ss_pred             CCCccccEeccCccccccc
Q 032901           14 GRGHVKFIRCSNCGKCCPK   32 (130)
Q Consensus        14 grGhv~~V~C~NCgr~vPK   32 (130)
                      +.|+-+.-+|.||++.+-|
T Consensus        18 s~~~irLt~C~~C~~vaDk   36 (208)
T PF04161_consen   18 SPGNIRLTKCPNCGKVADK   36 (208)
T ss_pred             CCCcEEEeeccccCCcccc
Confidence            4578888999999999998


No 43 
>PF00374 NiFeSe_Hases:  Nickel-dependent hydrogenase;  InterPro: IPR001501 Hydrogenases are enzymes that catalyze the reversible activation of hydrogen and which occur widely in prokaryotes as well as in some eukaryotes. There are various types of hydrogenases, but all of them seem to contain at least one iron-sulphur cluster. They can be broadly divided into two groups: hydrogenases containing nickel and, in some cases, also selenium (the [NiFe] and [NiFeSe] hydrogenases) and those lacking nickel (the [Fe] hydrogenases). The [NiFe] and [NiFeSe] hydrogenases are heterodimer that consist of a small subunit that contains a signal peptide and a large subunit. All the known large subunits seem to be evolutionary related []; they contain two Cys-x-x-Cys motifs; one at their N-terminal end; the other at their C-terminal end. These four cysteines are involved in the binding of nickel []. In the [NiFeSe] hydrogenases the first cysteine of the C-terminal motif is a selenocysteine which has experimentally been shown to be a nickel ligand [].; GO: 0016151 nickel ion binding; PDB: 1E3D_D 3USC_M 3USE_L 3UQY_M 3RGW_L 1CC1_L 1YQ9_I 2FRV_D 1FRV_B 3MYR_F ....
Probab=20.47  E-value=23  Score=32.11  Aligned_cols=8  Identities=63%  Similarity=1.526  Sum_probs=5.2

Q ss_pred             eeeeecee
Q 032901           71 YCVSCAIH   78 (130)
Q Consensus        71 YCVSCAIH   78 (130)
                      =|+|||+|
T Consensus       500 PCisCavH  507 (507)
T PF00374_consen  500 PCISCAVH  507 (507)
T ss_dssp             -BHHHHH-
T ss_pred             ccccccCc
Confidence            48888888


No 44 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=20.34  E-value=41  Score=18.53  Aligned_cols=13  Identities=31%  Similarity=0.600  Sum_probs=8.9

Q ss_pred             cEeccCccccccc
Q 032901           20 FIRCSNCGKCCPK   32 (130)
Q Consensus        20 ~V~C~NCgr~vPK   32 (130)
                      .+.|.|||.-++.
T Consensus         2 ~~~Cp~Cg~~~~~   14 (26)
T PF13248_consen    2 EMFCPNCGAEIDP   14 (26)
T ss_pred             cCCCcccCCcCCc
Confidence            3568888886654


No 45 
>PF14424 Toxin-deaminase:  The  BURPS668_1122 family of deaminases
Probab=20.01  E-value=64  Score=24.35  Aligned_cols=31  Identities=19%  Similarity=0.403  Sum_probs=20.1

Q ss_pred             hhHHHHhHHHhcccccccc-----ceeeeeeeeeeeec
Q 032901           44 EQAAVRDVQEACVYDGYTL-----PKLYAKMQYCVSCA   76 (130)
Q Consensus        44 EaaavRDi~eAsv~~~y~l-----PKlyvKl~YCVSCA   76 (130)
                      |+-++++|.+.-  ..-.+     -+||..+.+|-||-
T Consensus        77 E~KiL~~ia~~l--~~~~~~~~G~i~l~te~~pC~SC~  112 (133)
T PF14424_consen   77 EYKILEDIAKKL--GDNPDPSGGTIDLFTELPPCESCS  112 (133)
T ss_pred             HHHHHHHHHHHh--ccccccCCceEEEEecCCcChhHH
Confidence            445677775532  22222     26999999999994


Done!