BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032908
         (130 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YZR|A Chain A, Crystal Structure Of Pyridoxine Biosynthesis Protein
          From Methanocaldococcus Jannaschii
 pdb|2YZR|B Chain B, Crystal Structure Of Pyridoxine Biosynthesis Protein
          From Methanocaldococcus Jannaschii
 pdb|2YZR|C Chain C, Crystal Structure Of Pyridoxine Biosynthesis Protein
          From Methanocaldococcus Jannaschii
          Length = 330

 Score = 27.7 bits (60), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 10 LLKFGFGLMLMHMISMNLLHVE-AQVAVDESRLELMS 45
          LLK GF  M+ H + M++ +VE AQ+A +   + +M+
Sbjct: 7  LLKKGFAKMVKHGVVMDVTNVEQAQIAEEAGAVAVMA 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.137    0.440 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,175,526
Number of Sequences: 62578
Number of extensions: 91226
Number of successful extensions: 235
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 235
Number of HSP's gapped (non-prelim): 1
length of query: 130
length of database: 14,973,337
effective HSP length: 88
effective length of query: 42
effective length of database: 9,466,473
effective search space: 397591866
effective search space used: 397591866
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)