Citrus Sinensis ID: 032971


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MALAPATVKLLKFGIGLMLMHMISMNLLHVEAQVAVDESRLELMSDALEWPMLSMSFDEEEGEGPEGEGGRRSLFWQRMKYYISYGALSANRIPCPPRSGRSYYTPNCYKARGPVHPYTRGCSVITRCRR
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccEEccccccEEEcccccccccccccccccccccccccccccccccccccccccHHcccc
*****ATVKLLKFGIGLMLMHMISMNLLHVEAQVAVDESRLELMSDALEWP*********************SLFWQRMKYYISYGALSANRIPCPPRSGRSYYTPNCYKARGPVHPYTRGCSVITRCRR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALAPATVKLLKFGIGLMLMHMISMNLLHVEAQVAVDESRLELMSDALEWPMLSMSFDEEEGEGPEGEGGRRSLFWQRMKYYISYGALSANRIPCPPRSGRSYYTPNCYKARGPVHPYTRGCSVITRCRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein RALF-like 34 Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases.probableQ9FHA6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted