BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032986
(129 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4D93|A Chain A, Crystal Structure Of Tep1s
pdb|4D93|B Chain B, Crystal Structure Of Tep1s
pdb|4D93|C Chain C, Crystal Structure Of Tep1s
Length = 1323
Score = 26.6 bits (57), Expect = 4.3, Method: Composition-based stats.
Identities = 12/39 (30%), Positives = 19/39 (48%)
Query: 89 YLIYQTMAIGNLTTVGIFAGTSIIWMLLQWNARQQVHPK 127
+ +Y M+ GN+ G LLQ NA +++ PK
Sbjct: 430 FFVYYVMSKGNIIDAGFMRPNKQTKYLLQLNATEKMIPK 468
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.331 0.140 0.489
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,495,214
Number of Sequences: 62578
Number of extensions: 104678
Number of successful extensions: 193
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 192
Number of HSP's gapped (non-prelim): 4
length of query: 129
length of database: 14,973,337
effective HSP length: 88
effective length of query: 41
effective length of database: 9,466,473
effective search space: 388125393
effective search space used: 388125393
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)