Query         032990
Match_columns 129
No_of_seqs    105 out of 328
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 08:26:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032990.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032990hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399 Predicted Yippee-type  100.0 1.4E-52 3.1E-57  309.8  -2.9  117    1-117     1-119 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 1.6E-32 3.6E-37  192.0   6.1   88   13-106     2-93  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  96.7  0.0018 3.9E-08   47.8   3.5   88   13-102     4-93  (123)
  4 TIGR00357 methionine-R-sulfoxi  94.2   0.056 1.2E-06   41.0   3.4   65   12-84     39-104 (134)
  5 PRK00222 methionine sulfoxide   94.1   0.045 9.8E-07   41.9   2.8   67   12-85     42-108 (142)
  6 PRK05508 methionine sulfoxide   93.4     0.1 2.2E-06   39.0   3.5   62   12-83     32-93  (119)
  7 PF01641 SelR:  SelR domain;  I  93.3   0.077 1.7E-06   39.7   2.7   70   12-88     36-105 (124)
  8 PRK05550 bifunctional methioni  91.4    0.17 3.7E-06   42.5   2.8   63   12-84     35-97  (283)
  9 PRK14018 trifunctional thiored  90.1    0.33 7.1E-06   43.9   3.6   67   12-85    417-483 (521)
 10 PF14976 FAM72:  FAM72 protein   89.6    0.71 1.5E-05   35.8   4.6   63   12-86     14-88  (150)
 11 KOG0856 Predicted pilin-like t  87.3    0.97 2.1E-05   34.9   4.0   67   10-84     51-118 (146)
 12 COG0229 Conserved domain frequ  79.4     3.1 6.7E-05   31.9   3.9   64   12-82     41-104 (140)
 13 PF09814 HECT_2:  HECT-like Ubi  68.2     8.7 0.00019   31.8   4.3   17   13-29    106-122 (354)
 14 PRK02935 hypothetical protein;  66.1     4.5 9.7E-05   29.9   1.9   25   11-35     84-108 (110)
 15 PF11023 DUF2614:  Protein of u  55.1     5.5 0.00012   29.7   0.7   25   11-35     83-107 (114)
 16 PF04828 GFA:  Glutathione-depe  51.6      14  0.0003   23.9   2.2   48   53-108    32-79  (92)
 17 TIGR02820 formald_GSH S-(hydro  43.4      28 0.00061   27.5   3.1   30   53-83     74-103 (182)
 18 TIGR01053 LSD1 zinc finger dom  42.1      24 0.00052   20.3   1.9   19    4-22      9-28  (31)
 19 COG3791 Uncharacterized conser  33.8      28 0.00061   25.5   1.7   22   65-86     65-86  (133)
 20 PF03811 Zn_Tnp_IS1:  InsA N-te  33.6      27 0.00058   20.7   1.2   27   68-94      4-31  (36)
 21 PF14803 Nudix_N_2:  Nudix N-te  29.7      25 0.00054   20.6   0.7   14   71-84      2-15  (34)
 22 PF06943 zf-LSD1:  LSD1 zinc fi  28.8      51  0.0011   18.2   1.8   19    3-21      5-24  (25)
 23 PF00412 LIM:  LIM domain;  Int  26.6      32  0.0007   20.7   0.8   15   13-27     26-40  (58)
 24 TIGR00037 eIF_5A translation i  26.0      77  0.0017   23.5   2.9   30   35-64     35-64  (130)
 25 PF10955 DUF2757:  Protein of u  24.7      35 0.00075   23.6   0.8   16   13-28      4-19  (76)
 26 PF13842 Tnp_zf-ribbon_2:  DDE_  23.6      65  0.0014   18.4   1.6   15   12-26     15-29  (32)
 27 PF00096 zf-C2H2:  Zinc finger,  23.4      13 0.00029   18.6  -1.2   16   14-29      1-16  (23)
 28 PLN03107 eukaryotic translatio  23.0      93   0.002   24.0   2.9   30   35-64     49-78  (159)
 29 smart00132 LIM Zinc-binding do  22.6      33 0.00071   18.5   0.3   11   14-24     28-38  (39)
 30 PF13912 zf-C2H2_6:  C2H2-type   22.5      12 0.00026   19.6  -1.6   18   13-30      1-18  (27)
 31 PRK05417 glutathione-dependent  22.3      87  0.0019   24.9   2.7   41   65-109    89-129 (191)
 32 PF10058 DUF2296:  Predicted in  21.7      28 0.00061   22.3  -0.2   35   44-83      2-36  (54)
 33 PF13465 zf-H2C2_2:  Zinc-finge  21.6      59  0.0013   17.2   1.2   11   12-22     13-23  (26)
 34 PF13248 zf-ribbon_3:  zinc-rib  21.4      31 0.00067   18.6  -0.0   11   69-79     16-26  (26)
 35 PF02945 Endonuclease_7:  Recom  21.3      14 0.00031   25.5  -1.7   16   67-82     50-65  (81)
 36 PF10238 Eapp_C:  E2F-associate  20.7      64  0.0014   24.4   1.6   24   12-35     28-54  (136)

No 1  
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=100.00  E-value=1.4e-52  Score=309.77  Aligned_cols=117  Identities=60%  Similarity=1.018  Sum_probs=114.1

Q ss_pred             CCceeEEccCCc--eEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCc
Q 032990            1 MGRLFVVNLEGK--IYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSI   78 (129)
Q Consensus         1 MGr~f~~~l~g~--~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~   78 (129)
                      |||+|..+|.++  .|+|++|+|||+.++|||||+|+|++|+||||++|+||..|+.++|.|+||+|+|+||+|+.|++.
T Consensus         1 mgR~F~~~l~~~~~~y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~~   80 (122)
T KOG3399|consen    1 MGRLFEAMLEANHRLYSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGTG   80 (122)
T ss_pred             CcchHHHHhccCCceEeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCCC
Confidence            999999999984  899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeEEeecccCcceecCeEEEEeeeeeCCCCCCccccc
Q 032990           79 VGWKYETAHEKSQKYKEGKSVLERFKVSGPDGSNYWVSH  117 (129)
Q Consensus        79 LGWkY~~A~e~sqkYKEGKfILE~~~i~~~~g~~~~~~~  117 (129)
                      |||||+.|||+||||||||||||+++|.+++|+|.+++.
T Consensus        81 ~GWkYe~a~e~sQkyKEGk~ilE~~~i~~~~g~~~~~~~  119 (122)
T KOG3399|consen   81 LGWKYEHAYEKSQKYKEGKFILELAEIFKPEGWDLEVGA  119 (122)
T ss_pred             cceeeeeccCchhhhcCcchHHHHHHhcCCCCchhhcCC
Confidence            999999999999999999999999999999999988743


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=99.97  E-value=1.6e-32  Score=192.04  Aligned_cols=88  Identities=58%  Similarity=1.050  Sum_probs=84.4

Q ss_pred             eEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeecc----EEEEeeeeecCCCceeeeEEeecc
Q 032990           13 IYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGM----HTVADIFCVGCGSIVGWKYETAHE   88 (129)
Q Consensus        13 ~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~----h~V~DI~C~~C~~~LGWkY~~A~e   88 (129)
                      +|.|++|++||+++++|+|  |+|+.|+||||+   ||..+++++|.|+||.    |+|+||+|++|++.|||||+.|++
T Consensus         2 vf~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~   76 (96)
T PF03226_consen    2 VFQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPE   76 (96)
T ss_pred             EEECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCH
Confidence            7999999999999999999  999999999998   7777888999999999    999999999999999999999999


Q ss_pred             cCcceecCeEEEEeeeee
Q 032990           89 KSQKYKEGKSVLERFKVS  106 (129)
Q Consensus        89 ~sqkYKEGKfILE~~~i~  106 (129)
                      + |+||||+||||++.|.
T Consensus        77 ~-~~~k~g~file~~~i~   93 (96)
T PF03226_consen   77 E-QKYKEGKFILEKASIS   93 (96)
T ss_pred             h-HhhhCCEEEEEhhHEE
Confidence            9 9999999999999885


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=96.71  E-value=0.0018  Score=47.77  Aligned_cols=88  Identities=16%  Similarity=0.138  Sum_probs=59.1

Q ss_pred             eEEeccCCCCCCCCCCccccccc--CCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeEEeecccC
Q 032990           13 IYSCKHCRTHLALCEDVVSKSFH--CRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYETAHEKS   90 (129)
Q Consensus        13 ~y~C~~C~thLa~~~~lISk~F~--G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~~A~e~s   90 (129)
                      .+.|++|.+.++..+||-.-.-+  =--.+.  |...+.+...+++.....-+......|+|..|+..+|-.+..---+=
T Consensus         4 ~llC~kC~~~~C~~~DIr~ie~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~~L   81 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKIENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGVEL   81 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEETTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTEEE
T ss_pred             EEECCCCCceeEchhheEEecCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCccc
Confidence            47899999999999999443111  000111  33555555555554455568889999999999999998876654445


Q ss_pred             cceecCeEEEEe
Q 032990           91 QKYKEGKSVLER  102 (129)
Q Consensus        91 qkYKEGKfILE~  102 (129)
                      +-.|.-.|+++.
T Consensus        82 P~L~iksfvv~~   93 (123)
T PF11648_consen   82 PCLKIKSFVVEL   93 (123)
T ss_dssp             EEE-GGGEEEEE
T ss_pred             cEEEeeeeeeee
Confidence            667777777544


No 4  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.22  E-value=0.056  Score=41.02  Aligned_cols=65  Identities=23%  Similarity=0.460  Sum_probs=40.7

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeee-eecccCcccceeeeeccEEEEeeeeecCCCceeeeEE
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKV-VNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYE   84 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v-~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~   84 (129)
                      -+|.|+.|+++|-++++    .|....|=.-.+..+ -|. +...++..  -|+.. ..|.|..|+.+||--..
T Consensus        39 G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~-V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~  104 (134)
T TIGR00357        39 GIYVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEV-VAYERDES--HGMIR-TEVRCRNCDAHLGHVFD  104 (134)
T ss_pred             eEEEccCCCCccccccc----hhcCCCCCcCcCcccCCCc-eEEeecCC--CCcEE-EEEEecCCCCccCcccC
Confidence            67999999999987764    455555544444444 222 22233322  13333 58999999999996554


No 5  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=94.14  E-value=0.045  Score=41.91  Aligned_cols=67  Identities=21%  Similarity=0.417  Sum_probs=41.1

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeEEe
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYET   85 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~~   85 (129)
                      -+|.|+.|.++|=+++    ..|.-..|=.-.+..+-.-.+...+++.  -|+. =..|.|..|+.+||-....
T Consensus        42 G~Y~C~~Cg~pLF~S~----~Kf~Sg~GWPSF~~~i~~~~V~~~~D~s--~gm~-RtEv~C~~Cg~HLGHVF~D  108 (142)
T PRK00222         42 GIYVCIVCGEPLFSSD----TKFDSGCGWPSFTKPIDEEAIRELRDTS--HGMV-RTEVRCANCDSHLGHVFPD  108 (142)
T ss_pred             eEEEecCCCchhcCCc----ccccCCCCCcCcCcccCCCceEEeeccC--CCce-EEEEEeCCCCCccCcccCC
Confidence            6799999999998774    3466556655445444211122222221  1222 2589999999999966543


No 6  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=93.42  E-value=0.1  Score=38.99  Aligned_cols=62  Identities=26%  Similarity=0.519  Sum_probs=41.1

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeE
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKY   83 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY   83 (129)
                      -+|.|+.|.++|=++++    .|.-..|=.-.+..+-|. +...++..   |  .=..|.|..|+.+||--.
T Consensus        32 G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~-v~~~~D~~---~--~RtEv~C~~C~~HLGHVF   93 (119)
T PRK05508         32 GTYVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKGA-VKRIPDAD---G--RRTEIVCANCGGHLGHVF   93 (119)
T ss_pred             eEEEecCCCCccccccc----cccCCCCCcccCcccccc-eEEEecCC---C--cEEEEEeCCCCCccCccc
Confidence            67999999999987754    466556654445544332 22333433   2  246899999999999554


No 7  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=93.28  E-value=0.077  Score=39.73  Aligned_cols=70  Identities=26%  Similarity=0.509  Sum_probs=41.6

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeEEeecc
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYETAHE   88 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~~A~e   88 (129)
                      -+|.|+.|+++|=+++    ..|....|=.-.+..+..-.+....+..+  |+ .-..|.|..|+.+||=-......
T Consensus        36 G~Y~C~~Cg~pLF~S~----~Kf~Sg~GWPSF~~~i~~~~v~~~~D~s~--g~-~R~Ev~C~~Cg~HLGHVF~DGp~  105 (124)
T PF01641_consen   36 GIYVCAVCGTPLFSSD----TKFDSGCGWPSFWQPIPGDAVKEREDFSH--GM-VRTEVRCARCGSHLGHVFDDGPP  105 (124)
T ss_dssp             EEEEETTTS-EEEEGG----GEETSSSSSSEESSCSSTTSEEEEEEECT--SS-EEEEEEETTTCCEEEEEESTSST
T ss_pred             EEEEcCCCCCccccCc----ccccCCcCCccccCcCChHHEEEeccccC--Cc-eEEEEEecCCCCccccEeCCCCC
Confidence            6799999999997665    34555555444444333212222222221  33 34589999999999976655444


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=91.43  E-value=0.17  Score=42.53  Aligned_cols=63  Identities=24%  Similarity=0.509  Sum_probs=41.8

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeEE
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYE   84 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~   84 (129)
                      -+|.|+.|+++|=++++    .|.-.+|=.-.++.+-|-.. ..++..   |+  =..|.|..|+.+||--..
T Consensus        35 G~y~c~~c~~~LF~s~~----Kf~sg~GWPsF~~~~~~~~~-~~~d~~---~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         35 GVYLCRRCGAPLFRSED----KFNSGCGWPSFDDEIPGAVK-RLPDAD---GR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             cEEEcCCCCchhcCChh----hccCCCCCcCcCcccCCccE-EEEcCC---Cc--eEEEEecCCCCccCcccC
Confidence            67999999999987653    46655665444655544322 222222   32  479999999999996654


No 9  
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=90.13  E-value=0.33  Score=43.85  Aligned_cols=67  Identities=13%  Similarity=0.125  Sum_probs=42.1

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeEEe
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKYET   85 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~~   85 (129)
                      -+|.|+.|+++|=++.    ..|....|=.-.+..+-+-.+....+..  -|+.. ..|.|..|+.+||-....
T Consensus       417 G~y~c~~c~~pLf~s~----~Kf~sg~GWPsF~~~i~~~~v~~~~d~s--~g~~R-~Ev~c~~c~~HLGHvf~d  483 (521)
T PRK14018        417 GIYVDVVSGEPLFSSA----DKYDSGCGWPSFTRPIDAKVVTEHDDFS--YNMRR-TEVRSRAADSHLGHVFPD  483 (521)
T ss_pred             EEEEecCCCCccccCc----ccccCCCCCcccCcccCcCceEEeeccC--CCceE-EEEEECCCCCcCCcccCC
Confidence            6799999999998875    4466555544444444322222223321  13333 489999999999966644


No 10 
>PF14976 FAM72:  FAM72 protein
Probab=89.61  E-value=0.71  Score=35.76  Aligned_cols=63  Identities=30%  Similarity=0.572  Sum_probs=41.1

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeeccc---C-cccceeeeecc--------EEEEeeeeecCCCce
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSV---G-EKEERLMMTGM--------HTVADIFCVGCGSIV   79 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~---g-~~~~r~m~TG~--------h~V~DI~C~~C~~~L   79 (129)
                      .+..|+.|.+-|+...           =||.|..+ +|+.+   . ||....-.+|.        =.++||-|.+|+..|
T Consensus        14 ~~L~C~~C~~~l~~Rg-----------MkAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~v   81 (150)
T PF14976_consen   14 YILCCKFCDQVLCNRG-----------MKAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIV   81 (150)
T ss_pred             EEEECCCCCchhccch-----------hhheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCee
Confidence            4588999999887543           25666554 33332   1 23323323333        389999999999999


Q ss_pred             eeeEEee
Q 032990           80 GWKYETA   86 (129)
Q Consensus        80 GWkY~~A   86 (129)
                      |+.++..
T Consensus        82 GYhV~~P   88 (150)
T PF14976_consen   82 GYHVVVP   88 (150)
T ss_pred             eeEEEEE
Confidence            9888754


No 11 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=87.31  E-value=0.97  Score=34.86  Aligned_cols=67  Identities=22%  Similarity=0.459  Sum_probs=38.1

Q ss_pred             CCceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceee-eeccEEEEeeeeecCCCceeeeEE
Q 032990           10 EGKIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLM-MTGMHTVADIFCVGCGSIVGWKYE   84 (129)
Q Consensus        10 ~g~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m-~TG~h~V~DI~C~~C~~~LGWkY~   84 (129)
                      +.-+|.|..|.++|-.+.    ..|....|=--.|+.+ +  .|....+.. .-|.+ =.+|.|..|+.+||--.+
T Consensus        51 e~GvY~C~~C~~pLykS~----tKfdsgcGWPAF~e~i-~--~gaI~r~~d~s~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   51 EEGVYVCAGCGTPLYKST----TKFDSGCGWPAFFEAI-G--PGAITRTPDNSRGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CCceEEEeecCCcccccc----ccccCCCCCchhhhcc-C--CCceeeccccCCCCc-ceEEEEeecCCceeeeec
Confidence            457899999999997764    3455555543333332 0  111111111 01111 248999999999995543


No 12 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=79.45  E-value=3.1  Score=31.95  Aligned_cols=64  Identities=28%  Similarity=0.482  Sum_probs=39.0

Q ss_pred             ceEEeccCCCCCCCCCCcccccccCCCCeeeeeeeeeecccCcccceeeeeccEEEEeeeeecCCCceeee
Q 032990           12 KIYSCKHCRTHLALCEDVVSKSFHCRHGKAYLFSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWK   82 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWk   82 (129)
                      -+|.|..|..+|-++++    .|.-..|=--.+..+..-.+...++++  -|++. ..|.|..|+++||--
T Consensus        41 GiY~c~~cg~pLF~S~~----KfdSgcGWPSF~~pi~~~~I~~~~D~S--~gM~R-tEVrc~~c~sHLGHV  104 (140)
T COG0229          41 GIYVCIVCGEPLFSSED----KFDSGCGWPSFTKPISPDAITYKEDRS--HGMVR-TEVRCANCDSHLGHV  104 (140)
T ss_pred             ceEEeecCCCccccccc----cccCCCCCccccccCCcccceEeeccC--CCcEE-EEEEecCCCCccccc
Confidence            68999999999987764    344444433333333332333333322  23333 479999999999943


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=68.19  E-value=8.7  Score=31.81  Aligned_cols=17  Identities=18%  Similarity=0.608  Sum_probs=13.7

Q ss_pred             eEEeccCCCCCCCCCCc
Q 032990           13 IYSCKHCRTHLALCEDV   29 (129)
Q Consensus        13 ~y~C~~C~thLa~~~~l   29 (129)
                      .+.|++|++.|.....+
T Consensus       106 ~~~C~~C~~~li~~~~~  122 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRNF  122 (354)
T ss_pred             EEECCCCCCcccCcccc
Confidence            69999999999766443


No 14 
>PRK02935 hypothetical protein; Provisional
Probab=66.12  E-value=4.5  Score=29.92  Aligned_cols=25  Identities=32%  Similarity=0.732  Sum_probs=21.8

Q ss_pred             CceEEeccCCCCCCCCCCccccccc
Q 032990           11 GKIYSCKHCRTHLALCEDVVSKSFH   35 (129)
Q Consensus        11 g~~y~C~~C~thLa~~~~lISk~F~   35 (129)
                      ||+..|-+|++||+...++--|.|.
T Consensus        84 GrvD~CM~C~~PLTLd~~legkefd  108 (110)
T PRK02935         84 GRVDACMHCNQPLTLDRSLEGKEFD  108 (110)
T ss_pred             cceeecCcCCCcCCcCccccccCcC
Confidence            6889999999999999988777664


No 15 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=55.11  E-value=5.5  Score=29.65  Aligned_cols=25  Identities=32%  Similarity=0.751  Sum_probs=21.9

Q ss_pred             CceEEeccCCCCCCCCCCccccccc
Q 032990           11 GKIYSCKHCRTHLALCEDVVSKSFH   35 (129)
Q Consensus        11 g~~y~C~~C~thLa~~~~lISk~F~   35 (129)
                      |+...|-+|++||+...++--|.|+
T Consensus        83 Gr~D~CM~C~~pLTLd~~legkef~  107 (114)
T PF11023_consen   83 GRVDACMHCKEPLTLDPSLEGKEFD  107 (114)
T ss_pred             chhhccCcCCCcCccCchhhcchhh
Confidence            5778999999999999999887775


No 16 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=51.62  E-value=14  Score=23.94  Aligned_cols=48  Identities=19%  Similarity=0.202  Sum_probs=24.3

Q ss_pred             CcccceeeeeccEEEEeeeeecCCCceeeeEEeecccCcceecCeEEEEeeeeeCC
Q 032990           53 GEKEERLMMTGMHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSGP  108 (129)
Q Consensus        53 g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY~~A~e~sqkYKEGKfILE~~~i~~~  108 (129)
                      |+..-+........+.-.+|..|++.|.+...        -..+.+.|-...|-++
T Consensus        32 g~~~l~~y~~s~~~~~r~FC~~CGs~l~~~~~--------~~~~~~~V~~g~ld~~   79 (92)
T PF04828_consen   32 GSENLKEYQFSGKGVERYFCPTCGSPLFSEDE--------RDPDLVGVNAGTLDDP   79 (92)
T ss_dssp             -GGGEEEC--TTSSCEEEEETTT--EEEEEES--------STTTEEEEEGGGBTT-
T ss_pred             ccccceEEEeCCCcCcCcccCCCCCeeecccC--------CCCCEEEEEeEeeCCC
Confidence            54444443324445666999999999997622        2234555555544443


No 17 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=43.41  E-value=28  Score=27.55  Aligned_cols=30  Identities=13%  Similarity=0.284  Sum_probs=18.0

Q ss_pred             CcccceeeeeccEEEEeeeeecCCCceeeeE
Q 032990           53 GEKEERLMMTGMHTVADIFCVGCGSIVGWKY   83 (129)
Q Consensus        53 g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY   83 (129)
                      |+...+....|.+. .--||..|++.|-++.
T Consensus        74 G~~~l~~Y~ss~~~-~R~FC~~CGS~L~~~~  103 (182)
T TIGR02820        74 NGDKLKVVDASATI-QRHACKGCGTHMYGRI  103 (182)
T ss_pred             CCcceEEEeCCCCE-EeecCCCCCCcccccc
Confidence            54443333334444 4449999999995544


No 18 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=42.10  E-value=24  Score=20.29  Aligned_cols=19  Identities=21%  Similarity=0.476  Sum_probs=14.1

Q ss_pred             eeEEccCC-ceEEeccCCCC
Q 032990            4 LFVVNLEG-KIYSCKHCRTH   22 (129)
Q Consensus         4 ~f~~~l~g-~~y~C~~C~th   22 (129)
                      .-+.|+.| +.+.|..|++.
T Consensus         9 t~L~yP~gA~~vrCs~C~~v   28 (31)
T TIGR01053         9 TLLMYPRGASSVRCALCQTV   28 (31)
T ss_pred             cEeecCCCCCeEECCCCCeE
Confidence            45677777 77888888763


No 19 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=33.83  E-value=28  Score=25.53  Aligned_cols=22  Identities=27%  Similarity=0.579  Sum_probs=16.7

Q ss_pred             EEEEeeeeecCCCceeeeEEee
Q 032990           65 HTVADIFCVGCGSIVGWKYETA   86 (129)
Q Consensus        65 h~V~DI~C~~C~~~LGWkY~~A   86 (129)
                      ..+.-.||..|+++|-|+....
T Consensus        65 ~~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          65 GSAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCCeecccCCCceEEecCCC
Confidence            3344449999999999997654


No 20 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=33.58  E-value=27  Score=20.70  Aligned_cols=27  Identities=26%  Similarity=0.432  Sum_probs=21.9

Q ss_pred             EeeeeecCCCce-eeeEEeecccCccee
Q 032990           68 ADIFCVGCGSIV-GWKYETAHEKSQKYK   94 (129)
Q Consensus        68 ~DI~C~~C~~~L-GWkY~~A~e~sqkYK   94 (129)
                      .+|.|..|++.- --|.-+.-.-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            479999999988 777777777778774


No 21 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=29.74  E-value=25  Score=20.59  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=7.2

Q ss_pred             eeecCCCceeeeEE
Q 032990           71 FCVGCGSIVGWKYE   84 (129)
Q Consensus        71 ~C~~C~~~LGWkY~   84 (129)
                      ||..|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            79999999988876


No 22 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=28.84  E-value=51  Score=18.23  Aligned_cols=19  Identities=26%  Similarity=0.576  Sum_probs=14.4

Q ss_pred             ceeEEccCC-ceEEeccCCC
Q 032990            3 RLFVVNLEG-KIYSCKHCRT   21 (129)
Q Consensus         3 r~f~~~l~g-~~y~C~~C~t   21 (129)
                      |..+.|+.| +.-.|..|++
T Consensus         5 r~~L~yp~GA~sVrCa~C~~   24 (25)
T PF06943_consen    5 RTLLMYPRGAPSVRCACCHT   24 (25)
T ss_pred             CceEEcCCCCCCeECCccCc
Confidence            456778888 7788888875


No 23 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=26.62  E-value=32  Score=20.66  Aligned_cols=15  Identities=20%  Similarity=0.583  Sum_probs=12.2

Q ss_pred             eEEeccCCCCCCCCC
Q 032990           13 IYSCKHCRTHLALCE   27 (129)
Q Consensus        13 ~y~C~~C~thLa~~~   27 (129)
                      -|.|..|+.+|...+
T Consensus        26 Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TSBETTTTCBTTTSS
T ss_pred             ccccCCCCCccCCCe
Confidence            388999999987765


No 24 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=25.95  E-value=77  Score=23.46  Aligned_cols=30  Identities=20%  Similarity=0.174  Sum_probs=24.6

Q ss_pred             cCCCCeeeeeeeeeecccCcccceeeeecc
Q 032990           35 HCRHGKAYLFSKVVNVSVGEKEERLMMTGM   64 (129)
Q Consensus        35 ~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~   64 (129)
                      .|+||.|+.--.+.|+..|...+..+.++-
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~   64 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTS   64 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCC
Confidence            588999999999999999988776665544


No 25 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=24.75  E-value=35  Score=23.62  Aligned_cols=16  Identities=31%  Similarity=0.850  Sum_probs=13.2

Q ss_pred             eEEeccCCCCCCCCCC
Q 032990           13 IYSCKHCRTHLALCED   28 (129)
Q Consensus        13 ~y~C~~C~thLa~~~~   28 (129)
                      .|.|++|++.+..-+.
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            3999999999877654


No 26 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=23.56  E-value=65  Score=18.38  Aligned_cols=15  Identities=27%  Similarity=0.660  Sum_probs=12.4

Q ss_pred             ceEEeccCCCCCCCC
Q 032990           12 KIYSCKHCRTHLALC   26 (129)
Q Consensus        12 ~~y~C~~C~thLa~~   26 (129)
                      ..|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            459999999988764


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=23.42  E-value=13  Score=18.63  Aligned_cols=16  Identities=19%  Similarity=0.613  Sum_probs=12.0

Q ss_pred             EEeccCCCCCCCCCCc
Q 032990           14 YSCKHCRTHLALCEDV   29 (129)
Q Consensus        14 y~C~~C~thLa~~~~l   29 (129)
                      |.|..|+..+...++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899998877766554


No 28 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=22.96  E-value=93  Score=23.98  Aligned_cols=30  Identities=20%  Similarity=0.308  Sum_probs=25.4

Q ss_pred             cCCCCeeeeeeeeeecccCcccceeeeecc
Q 032990           35 HCRHGKAYLFSKVVNVSVGEKEERLMMTGM   64 (129)
Q Consensus        35 ~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~   64 (129)
                      .|+||.|+.--.+.|+..|...++.+.++-
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~   78 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSH   78 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            599999999999999999998877766554


No 29 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=22.63  E-value=33  Score=18.53  Aligned_cols=11  Identities=27%  Similarity=0.951  Sum_probs=9.9

Q ss_pred             EEeccCCCCCC
Q 032990           14 YSCKHCRTHLA   24 (129)
Q Consensus        14 y~C~~C~thLa   24 (129)
                      |.|..|+..|+
T Consensus        28 f~C~~C~~~L~   38 (39)
T smart00132       28 FKCSKCGKPLG   38 (39)
T ss_pred             CCCcccCCcCc
Confidence            89999999886


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=22.53  E-value=12  Score=19.60  Aligned_cols=18  Identities=11%  Similarity=0.456  Sum_probs=13.1

Q ss_pred             eEEeccCCCCCCCCCCcc
Q 032990           13 IYSCKHCRTHLALCEDVV   30 (129)
Q Consensus        13 ~y~C~~C~thLa~~~~lI   30 (129)
                      +|.|..|+.-+.+...++
T Consensus         1 ~~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALR   18 (27)
T ss_dssp             SEEETTTTEEESSHHHHH
T ss_pred             CCCCCccCCccCChhHHH
Confidence            588999988776655543


No 31 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=22.29  E-value=87  Score=24.90  Aligned_cols=41  Identities=15%  Similarity=0.117  Sum_probs=27.2

Q ss_pred             EEEEeeeeecCCCceeeeEEeecccCcceecCeEEEEeeeeeCCC
Q 032990           65 HTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVLERFKVSGPD  109 (129)
Q Consensus        65 h~V~DI~C~~C~~~LGWkY~~A~e~sqkYKEGKfILE~~~i~~~~  109 (129)
                      ..+.--+|..|++.|-+.++..-.    --.|..+|-...+-++.
T Consensus        89 ~~i~R~FC~~CGS~L~~~~e~~~~----~~pgl~fV~~gllDd~~  129 (191)
T PRK05417         89 ATIQRHACKECGVHMYGRIENKDH----PFYGLDFVHTELSQEQG  129 (191)
T ss_pred             CCeEeeeCCCCCCccccccccccC----CCCCeEEEehhhcCCCC
Confidence            345556999999999887762201    12377888777766654


No 32 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=21.74  E-value=28  Score=22.27  Aligned_cols=35  Identities=26%  Similarity=0.441  Sum_probs=24.1

Q ss_pred             eeeeeecccCcccceeeeeccEEEEeeeeecCCCceeeeE
Q 032990           44 FSKVVNVSVGEKEERLMMTGMHTVADIFCVGCGSIVGWKY   83 (129)
Q Consensus        44 f~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~LGWkY   83 (129)
                      |++++++..|..+     |+...---+-|.+|.++=|---
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~   36 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAP   36 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccc
Confidence            5677788887666     3333334566999999999654


No 33 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=21.60  E-value=59  Score=17.25  Aligned_cols=11  Identities=36%  Similarity=0.836  Sum_probs=9.2

Q ss_pred             ceEEeccCCCC
Q 032990           12 KIYSCKHCRTH   22 (129)
Q Consensus        12 ~~y~C~~C~th   22 (129)
                      ++|.|..|..-
T Consensus        13 k~~~C~~C~k~   23 (26)
T PF13465_consen   13 KPYKCPYCGKS   23 (26)
T ss_dssp             SSEEESSSSEE
T ss_pred             CCCCCCCCcCe
Confidence            88999999753


No 34 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=21.43  E-value=31  Score=18.58  Aligned_cols=11  Identities=36%  Similarity=1.017  Sum_probs=5.8

Q ss_pred             eeeeecCCCce
Q 032990           69 DIFCVGCGSIV   79 (129)
Q Consensus        69 DI~C~~C~~~L   79 (129)
                      +-||..|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            44566665543


No 35 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=21.34  E-value=14  Score=25.51  Aligned_cols=16  Identities=25%  Similarity=0.696  Sum_probs=14.8

Q ss_pred             EEeeeeecCCCceeee
Q 032990           67 VADIFCVGCGSIVGWK   82 (129)
Q Consensus        67 V~DI~C~~C~~~LGWk   82 (129)
                      ||-+-|..|++.||+-
T Consensus        50 vRGlLC~~CN~~lG~~   65 (81)
T PF02945_consen   50 VRGLLCRSCNTALGKV   65 (81)
T ss_dssp             EEEEEEHHHHHHHHHC
T ss_pred             chhhhhhHHhhhhccc
Confidence            9999999999999975


No 36 
>PF10238 Eapp_C:  E2F-associated phosphoprotein;  InterPro: IPR019370 This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis []. 
Probab=20.69  E-value=64  Score=24.43  Aligned_cols=24  Identities=25%  Similarity=0.455  Sum_probs=18.7

Q ss_pred             ceEEeccCCCCCCCCCC---ccccccc
Q 032990           12 KIYSCKHCRTHLALCED---VVSKSFH   35 (129)
Q Consensus        12 ~~y~C~~C~thLa~~~~---lISk~F~   35 (129)
                      -+.+|..|-|.|+...+   .....|+
T Consensus        28 avLsCp~Cft~lc~dcQrHe~y~~QYR   54 (136)
T PF10238_consen   28 AVLSCPACFTTLCLDCQRHEKYKNQYR   54 (136)
T ss_pred             ceEeCccccceeeecccccchhcceee
Confidence            67999999999998766   5555554


Done!