Query         033000
Match_columns 129
No_of_seqs    150 out of 780
Neff          7.2 
Searched_HMMs 46136
Date          Fri Mar 29 08:33:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033000.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033000hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4198 RNA-binding Ran Zn-fin  99.7 1.9E-18 4.2E-23  134.4   6.3  121    4-129     5-165 (280)
  2 KOG4198 RNA-binding Ran Zn-fin  99.7 2.2E-17 4.8E-22  128.6   6.0  122    3-128    60-267 (280)
  3 PF00641 zf-RanBP:  Zn-finger i  99.0 1.4E-10   3E-15   62.0   2.0   30    4-33      1-30  (30)
  4 KOG1995 Conserved Zn-finger pr  99.0 3.5E-10 7.7E-15   90.3   3.7  122    3-129    67-244 (351)
  5 PF00641 zf-RanBP:  Zn-finger i  98.8 2.2E-09 4.8E-14   57.3   2.0   30   48-79      1-30  (30)
  6 smart00547 ZnF_RBZ Zinc finger  98.6 2.8E-08 6.1E-13   51.1   1.3   26    6-31      1-26  (26)
  7 smart00547 ZnF_RBZ Zinc finger  98.4   2E-07 4.3E-12   47.9   1.4   25   50-76      1-25  (26)
  8 KOG1995 Conserved Zn-finger pr  97.7 9.1E-05   2E-09   59.6   6.3   33   47-80    214-246 (351)
  9 PF12773 DZR:  Double zinc ribb  97.0 0.00076 1.6E-08   39.4   2.9   50   10-74      1-50  (50)
 10 PRK14559 putative protein seri  95.9  0.0067 1.5E-07   52.9   3.3   50    9-78      3-52  (645)
 11 PF12773 DZR:  Double zinc ribb  94.6   0.038 8.2E-07   32.0   2.6   50   54-125     1-50  (50)
 12 KOG4477 RING1 interactor RYBP   93.8   0.028   6E-07   42.0   1.0   29    5-33     22-50  (228)
 13 PF13248 zf-ribbon_3:  zinc-rib  92.2   0.067 1.5E-06   27.2   0.8   23    8-30      3-25  (26)
 14 PF13240 zinc_ribbon_2:  zinc-r  92.1   0.081 1.8E-06   26.2   1.0   22    9-30      1-22  (23)
 15 PF13248 zf-ribbon_3:  zinc-rib  91.4    0.13 2.7E-06   26.1   1.3   23   52-76      3-25  (26)
 16 KOG4477 RING1 interactor RYBP   91.0   0.097 2.1E-06   39.1   0.8   34   44-79     17-50  (228)
 17 PF13240 zinc_ribbon_2:  zinc-r  89.4    0.22 4.9E-06   24.6   1.2   22   53-76      1-22  (23)
 18 PRK14559 putative protein seri  87.4    0.53 1.2E-05   41.3   3.0   48   53-127     3-50  (645)
 19 cd00350 rubredoxin_like Rubred  86.0     0.7 1.5E-05   24.6   1.9   25   51-77      1-27  (33)
 20 PRK04136 rpl40e 50S ribosomal   84.1    0.53 1.2E-05   27.5   0.9   24    6-29     13-36  (48)
 21 cd00729 rubredoxin_SM Rubredox  83.3     1.1 2.3E-05   24.2   1.9   26   51-78      2-29  (34)
 22 PRK14714 DNA polymerase II lar  82.1     2.1 4.5E-05   40.4   4.3   52    8-80    668-722 (1337)
 23 COG1552 RPL40A Ribosomal prote  76.0    0.54 1.2E-05   27.6  -0.8   22    9-30     16-37  (50)
 24 KOG4345 NF-kappa B regulator A  75.0    0.29 6.2E-06   43.1  -3.1   75    1-77      1-115 (774)
 25 PRK04136 rpl40e 50S ribosomal   68.3     2.9 6.2E-05   24.5   1.0   25   50-76     13-37  (48)
 26 PF00301 Rubredoxin:  Rubredoxi  63.6     3.4 7.4E-05   24.0   0.7   13    4-16     31-43  (47)
 27 PF10571 UPF0547:  Uncharacteri  63.5     4.2 9.2E-05   20.6   1.0   21    9-29      2-22  (26)
 28 PF12172 DUF35_N:  Rubredoxin-l  62.8     4.3 9.2E-05   21.9   1.0   22   53-76     13-34  (37)
 29 PRK14714 DNA polymerase II lar  61.0     9.7 0.00021   36.1   3.4   50   50-127   666-718 (1337)
 30 COG1592 Rubrerythrin [Energy p  59.5     5.9 0.00013   29.1   1.5   26   51-78    134-160 (166)
 31 COG1773 Rubredoxin [Energy pro  57.5      17 0.00036   21.9   3.0   16   44-61     29-44  (55)
 32 PRK13130 H/ACA RNA-protein com  45.5      36 0.00079   20.4   3.1   23   53-79      7-29  (56)
 33 PF14803 Nudix_N_2:  Nudix N-te  44.0      16 0.00034   19.7   1.3   32   69-115     2-33  (34)
 34 COG3478 Predicted nucleic-acid  43.4      12 0.00026   23.4   0.8   16    6-21      3-18  (68)
 35 cd00730 rubredoxin Rubredoxin;  43.4      23 0.00049   20.7   2.0   12   99-112    31-42  (50)
 36 cd04718 BAH_plant_2 BAH, or Br  42.0      14  0.0003   26.6   1.1   16    4-19     15-30  (148)
 37 COG1066 Sms Predicted ATP-depe  39.1      24 0.00052   29.9   2.2   31    1-31      1-31  (456)
 38 PRK11823 DNA repair protein Ra  37.7      28 0.00061   29.1   2.4   32    1-32      1-32  (446)
 39 PF11023 DUF2614:  Protein of u  34.2      25 0.00055   24.2   1.4   32    2-33     64-97  (114)
 40 PF01020 Ribosomal_L40e:  Ribos  33.4      28 0.00062   20.6   1.3   22    8-29     18-41  (52)
 41 PRK04023 DNA polymerase II lar  32.9      59  0.0013   30.5   3.8   52    6-80    625-676 (1121)
 42 COG1545 Predicted nucleic-acid  32.6      33 0.00071   24.2   1.8   23   53-77     31-53  (140)
 43 PF04810 zf-Sec23_Sec24:  Sec23  32.2      23 0.00049   19.5   0.7   15    6-20     23-37  (40)
 44 TIGR02098 MJ0042_CXXC MJ0042 f  31.5      25 0.00054   18.7   0.8   11    9-19      4-14  (38)
 45 PRK05452 anaerobic nitric oxid  28.1      82  0.0018   26.7   3.7   16   44-61    451-466 (479)
 46 PHA00626 hypothetical protein   28.0      47   0.001   20.1   1.6   11    9-19      2-12  (59)
 47 COG1545 Predicted nucleic-acid  27.7      41 0.00089   23.7   1.6   23    9-31     31-53  (140)
 48 PF08271 TF_Zn_Ribbon:  TFIIB z  27.1      41 0.00089   18.5   1.2   12  100-113    17-28  (43)
 49 PF09862 DUF2089:  Protein of u  26.8      33 0.00072   23.6   1.0   22   10-31      1-22  (113)
 50 TIGR00416 sms DNA repair prote  25.8      56  0.0012   27.5   2.3   32    1-32      1-32  (454)
 51 TIGR00595 priA primosomal prot  24.9      62  0.0014   27.6   2.5   24   51-77    240-263 (505)
 52 PF14952 zf-tcix:  Putative tre  23.9      40 0.00087   19.3   0.8   16    9-24     13-28  (44)
 53 PRK00420 hypothetical protein;  23.8      46 0.00099   22.8   1.2   21    9-29     25-48  (112)
 54 PRK00398 rpoP DNA-directed RNA  23.6      57  0.0012   18.2   1.4    8   69-76     23-30  (46)
 55 KOG1512 PHD Zn-finger protein   23.4      37 0.00079   27.4   0.7   41    7-55    308-357 (381)
 56 COG1645 Uncharacterized Zn-fin  22.8      45 0.00098   23.6   1.0   10   68-77     29-38  (131)
 57 PF10058 DUF2296:  Predicted in  21.7      52  0.0011   19.5   1.0   33   21-63     22-54  (54)
 58 PF09297 zf-NADH-PPase:  NADH p  20.9      67  0.0015   16.5   1.3   10   22-31      4-13  (32)
 59 PF03604 DNA_RNApol_7kD:  DNA d  20.4      98  0.0021   16.3   1.8    7   58-64      5-11  (32)
 60 PRK14873 primosome assembly pr  20.3      80  0.0017   28.1   2.3   25   50-78    409-433 (665)

No 1  
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=99.75  E-value=1.9e-18  Score=134.45  Aligned_cols=121  Identities=34%  Similarity=0.722  Sum_probs=93.4

Q ss_pred             CCC-CeEcCccCccccccccccccCCCCCCCCCCCc------------ccccCCccccCCCcccCCCCCCCeecCCCcCc
Q 033000            4 PGG-DWMCAACQHQNFKKREACQRCGYPKYGGPDVS------------TYLCNRTEVLAGDWYCTAMNCGAHNYASRPNC   70 (129)
Q Consensus         4 ~~g-dW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~------------~~~~~~~~~~~gdW~C~~~~C~~~N~~~~~~C   70 (129)
                      ++| ||.|..|.++||..+..|.+|..+++. .++.            .+.+....+++|||.|+  .|+++||++|..|
T Consensus         5 r~g~~~~~~~~~~~~~~~~~~c~~c~~~~~~-i~~~~~~~~tid~~~~~~~~~~~~~~pgdw~c~--~c~~~n~arr~~c   81 (280)
T KOG4198|consen    5 RKGVDSLKRLCLHVNFDERDSCGRCSLSRAY-IQPDDDEARTIDVMRLLLTNSKDPPRPGDWNCP--LCGFHNSARRLLC   81 (280)
T ss_pred             cccCCcccchhhhhccccccccccccCCccc-ccccccccCccchhhhcccccCCCCCCcccccC--ccchhhHHHhhhc
Confidence            345 999999999999999999999999943 1111            11235788999999999  8999999999999


Q ss_pred             cccCCCCCCcccccc-c-----------ccCCC------CCCC---------CCCccCceeecCCCCCceeccCCccccC
Q 033000           71 YRCGAAKTDYACANM-M-----------AYGTD------GSVP---------PGWKSGDWICNRMGCGVHNYASRMVCYK  123 (129)
Q Consensus        71 ~~C~~~~~~~~~~~~-~-----------~~g~~------~~~~---------~~~~~gdW~C~~~~C~~~N~a~r~~C~~  123 (129)
                      ++|+.++++...... +           .+...      ..+.         ..+++|||+|+  .|+||||+++..|++
T Consensus        82 ~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~GDW~Cp--~C~fhNfarn~~C~r  159 (280)
T KOG4198|consen   82 FRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRSGDWECP--GCNFHNFARNSECFR  159 (280)
T ss_pred             ceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCccccCcccC--CCCceeccccchhhh
Confidence            999999877655310 0           11100      0000         13789999999  799999999999999


Q ss_pred             CCCCCC
Q 033000          124 CKTPRE  129 (129)
Q Consensus       124 C~~pk~  129 (129)
                      |+++++
T Consensus       160 C~~~r~  165 (280)
T KOG4198|consen  160 CGAKRP  165 (280)
T ss_pred             cCCcCc
Confidence            999875


No 2  
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=99.70  E-value=2.2e-17  Score=128.55  Aligned_cols=122  Identities=35%  Similarity=0.772  Sum_probs=89.8

Q ss_pred             CCCCCeEcCccCccccccccccccCCCCCCCCCC----Cccc--------cc---------------CC-----ccccCC
Q 033000            3 LPGGDWMCAACQHQNFKKREACQRCGYPKYGGPD----VSTY--------LC---------------NR-----TEVLAG   50 (129)
Q Consensus         3 ~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~----~~~~--------~~---------------~~-----~~~~~g   50 (129)
                      .++|||.|+.|+++||++|..|++|+.+++.-..    +...        .+               .+     .+.++|
T Consensus        60 ~~pgdw~c~~c~~~n~arr~~c~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~G  139 (280)
T KOG4198|consen   60 PRPGDWNCPLCGFHNSARRLLCFRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRSG  139 (280)
T ss_pred             CCCcccccCccchhhHHHhhhcceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCcccc
Confidence            4689999999999999999999999998864211    1100        00               11     147899


Q ss_pred             CcccCCCCCCCeecCCCcCccccCCCCCCccc-------cc---------cc-------------ccCC---------C-
Q 033000           51 DWYCTAMNCGAHNYASRPNCYRCGAAKTDYAC-------AN---------MM-------------AYGT---------D-   91 (129)
Q Consensus        51 dW~C~~~~C~~~N~~~~~~C~~C~~~~~~~~~-------~~---------~~-------------~~g~---------~-   91 (129)
                      ||+|+  .|++|||+++..|++|+++++..+.       ..         ..             .++.         . 
T Consensus       140 DW~Cp--~C~fhNfarn~~C~rC~~~r~~~a~~~~~~s~~~~~~~~s~~~~~~~~t~~~~~~r~~~~~~~~~~~~d~~~~  217 (280)
T KOG4198|consen  140 DWECP--GCNFHNFARNSECFRCGAKRPLAALLGNQASEATEHDWLSKVADSSSSTRFESLLRCNARGEMSESRVDGADV  217 (280)
T ss_pred             CcccC--CCCceeccccchhhhcCCcCcccccccccccccccccccccccccccceecccchhhcccCcccccccccccc
Confidence            99999  9999999999999999999987441       00         00             0000         0 


Q ss_pred             ---------------CCCCCCCccCceeecCCCCCceeccCCccccCCCCCC
Q 033000           92 ---------------GSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPR  128 (129)
Q Consensus        92 ---------------~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~~pk  128 (129)
                                     ..+....+.+||.|+  .|.++||.++.+|.+|..++
T Consensus       218 ~~~~~~~~e~~~~~~sr~s~~~~dgdw~~~--s~~~~~~r~r~a~~~c~~~~  267 (280)
T KOG4198|consen  218 KGNFSSDDESRLEPLSRGSKSSRDGDWMCE--SCKAENFRRRNACLKCISPR  267 (280)
T ss_pred             cccccccccccccccccCcccccCCCcccc--cccchhhhhhhhhhccccCc
Confidence                           011123678999999  79999999999999998775


No 3  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=99.02  E-value=1.4e-10  Score=61.95  Aligned_cols=30  Identities=40%  Similarity=0.991  Sum_probs=24.8

Q ss_pred             CCCCeEcCccCccccccccccccCCCCCCC
Q 033000            4 PGGDWMCAACQHQNFKKREACQRCGYPKYG   33 (129)
Q Consensus         4 ~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~   33 (129)
                      |+|+|.|+.|+++|++.+..|.+|+++||.
T Consensus         1 k~g~W~C~~C~~~N~~~~~~C~~C~~~rp~   30 (30)
T PF00641_consen    1 KEGDWKCPSCTFMNPASRSKCVACGAPRPG   30 (30)
T ss_dssp             -SSSEEETTTTEEEESSSSB-TTT--BTTB
T ss_pred             CCcCccCCCCcCCchHHhhhhhCcCCCCcC
Confidence            579999999999999999999999999984


No 4  
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]
Probab=98.98  E-value=3.5e-10  Score=90.29  Aligned_cols=122  Identities=24%  Similarity=0.379  Sum_probs=83.4

Q ss_pred             CCCCCeEcC--ccCccccccccccccCCCCCCCCC-CCccc-------ccCCccccCCCcccCCCCCCCeecCCCcCccc
Q 033000            3 LPGGDWMCA--ACQHQNFKKREACQRCGYPKYGGP-DVSTY-------LCNRTEVLAGDWYCTAMNCGAHNYASRPNCYR   72 (129)
Q Consensus         3 ~~~gdW~C~--~C~~~Nf~~r~~C~~C~~prp~~~-~~~~~-------~~~~~~~~~gdW~C~~~~C~~~N~~~~~~C~~   72 (129)
                      .+.++|+|+  .|.+.||.++.+|..|+..|.... .+.-+       .-+...+...||.|.  .|.+++|+.+.+|. 
T Consensus        67 ~ti~v~g~~d~~~~~~~~~~f~qcg~ikrnK~t~kPki~~y~dkeT~~~KGeatvS~~D~~~a--kaai~~~agkdf~g-  143 (351)
T KOG1995|consen   67 ETIFVWGCPDSVCENDNADFFLQCGVIKRNKRTGKPKIKIYTDKETGAPKGEATVSYEDPPAA--KAAIEWFAGKDFCG-  143 (351)
T ss_pred             ccceeeccCccchHHHHHHHHhhcceeccCCCCCCcchhccccccccCcCCceeeeecChhhh--hhhhhhhccccccC-
Confidence            346799998  899999999999999999998741 11110       113445556788888  88888888888887 


Q ss_pred             cCCCCCCccc--c-c------------ccccC-------------CC------------------CCCCCCCccCceeec
Q 033000           73 CGAAKTDYAC--A-N------------MMAYG-------------TD------------------GSVPPGWKSGDWICN  106 (129)
Q Consensus        73 C~~~~~~~~~--~-~------------~~~~g-------------~~------------------~~~~~~~~~gdW~C~  106 (129)
                       .+++.....  + +            ..+|+             ..                  .........+||.|+
T Consensus       144 -n~ikvs~a~~r~~ve~~rg~~~~~~g~g~fg~~~~grg~~~G~gg~~~~~~~~~rGg~~~~g~~g~~~~~~~d~Dw~c~  222 (351)
T KOG1995|consen  144 -NTIKVSLAERRTGVESVRGGYPNDGGAGEFGRLRGGRGGPGGPGGGDGEAGKGDRGGVPDGGESGGGNVQDEDGDWDCP  222 (351)
T ss_pred             -CCchhhhhhhccCcccccccccCcCCCCCccccccCCCCCCCCCCccccccccccCCcCCCcccCCccccccccccccc
Confidence             554432111  0 0            00000             00                  000123567899999


Q ss_pred             CCCCCceeccCCccccCCCCCCC
Q 033000          107 RMGCGVHNYASRMVCYKCKTPRE  129 (129)
Q Consensus       107 ~~~C~~~N~a~r~~C~~C~~pk~  129 (129)
                       +.|.++||+++..|++|+++|+
T Consensus       223 -~~c~N~nfa~r~~cnrck~~Kp  244 (351)
T KOG1995|consen  223 -PSCGNRNFAWREECNRCKAPKP  244 (351)
T ss_pred             -ccccccccccccccccccCCCc
Confidence             7899999999999999999985


No 5  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=98.82  E-value=2.2e-09  Score=57.26  Aligned_cols=30  Identities=43%  Similarity=0.947  Sum_probs=24.4

Q ss_pred             cCCCcccCCCCCCCeecCCCcCccccCCCCCC
Q 033000           48 LAGDWYCTAMNCGAHNYASRPNCYRCGAAKTD   79 (129)
Q Consensus        48 ~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~~~   79 (129)
                      ++|+|.|+  .|+++|++++..|.+|+++||.
T Consensus         1 k~g~W~C~--~C~~~N~~~~~~C~~C~~~rp~   30 (30)
T PF00641_consen    1 KEGDWKCP--SCTFMNPASRSKCVACGAPRPG   30 (30)
T ss_dssp             -SSSEEET--TTTEEEESSSSB-TTT--BTTB
T ss_pred             CCcCccCC--CCcCCchHHhhhhhCcCCCCcC
Confidence            46899999  9999999999999999999973


No 6  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=98.55  E-value=2.8e-08  Score=51.11  Aligned_cols=26  Identities=50%  Similarity=1.198  Sum_probs=24.5

Q ss_pred             CCeEcCccCccccccccccccCCCCC
Q 033000            6 GDWMCAACQHQNFKKREACQRCGYPK   31 (129)
Q Consensus         6 gdW~C~~C~~~Nf~~r~~C~~C~~pr   31 (129)
                      |||+|+.|+++|++.+..|.+|++|.
T Consensus         1 g~W~C~~C~~~N~~~~~~C~~C~~p~   26 (26)
T smart00547        1 GDWECPACTFLNFASRSKCFACGAPX   26 (26)
T ss_pred             CcccCCCCCCcChhhhccccccCCcC
Confidence            79999999999999999999999873


No 7  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=98.35  E-value=2e-07  Score=47.89  Aligned_cols=25  Identities=52%  Similarity=1.285  Sum_probs=23.9

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCC
Q 033000           50 GDWYCTAMNCGAHNYASRPNCYRCGAA   76 (129)
Q Consensus        50 gdW~C~~~~C~~~N~~~~~~C~~C~~~   76 (129)
                      |+|+|+  .|+++|++.+..|..|++|
T Consensus         1 g~W~C~--~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        1 GDWECP--ACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             CcccCC--CCCCcChhhhccccccCCc
Confidence            699999  9999999999999999986


No 8  
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]
Probab=97.72  E-value=9.1e-05  Score=59.65  Aligned_cols=33  Identities=42%  Similarity=0.912  Sum_probs=30.3

Q ss_pred             ccCCCcccCCCCCCCeecCCCcCccccCCCCCCc
Q 033000           47 VLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDY   80 (129)
Q Consensus        47 ~~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~~~~   80 (129)
                      ..++||.|+ ..|.++||+.+..|++|.++||..
T Consensus       214 ~~d~Dw~c~-~~c~N~nfa~r~~cnrck~~Kp~~  246 (351)
T KOG1995|consen  214 DEDGDWDCP-PSCGNRNFAWREECNRCKAPKPER  246 (351)
T ss_pred             ccccccccc-ccccccccccccccccccCCCccc
Confidence            566899999 899999999999999999999865


No 9  
>PF12773 DZR:  Double zinc ribbon
Probab=97.01  E-value=0.00076  Score=39.39  Aligned_cols=50  Identities=32%  Similarity=0.672  Sum_probs=42.8

Q ss_pred             cCccCccccccccccccCCCCCCCCCCCcccccCCccccCCCcccCCCCCCCeecCCCcCccccC
Q 033000           10 CAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCG   74 (129)
Q Consensus        10 C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~~~~C~~C~   74 (129)
                      |+.|+..|......|..|+++-+..             ....++|+  .|+..|......|..||
T Consensus         1 Cp~Cg~~~~~~~~fC~~CG~~l~~~-------------~~~~~~C~--~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPHCGTPLPPP-------------DQSKKICP--NCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCcCCcCCccccCChhhcCChhhc-------------cCCCCCCc--CCcCCCcCCcCccCccc
Confidence            7899999999999999999986611             12368999  99999999999999986


No 10 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=95.95  E-value=0.0067  Score=52.92  Aligned_cols=50  Identities=30%  Similarity=0.737  Sum_probs=43.7

Q ss_pred             EcCccCccccccccccccCCCCCCCCCCCcccccCCccccCCCcccCCCCCCCeecCCCcCccccCCCCC
Q 033000            9 MCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKT   78 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~~   78 (129)
                      .|+.|++.|.....+|.+|+++-...                  .|+  .|+..+......|..||++-.
T Consensus         3 ~Cp~Cg~~n~~~akFC~~CG~~l~~~------------------~Cp--~CG~~~~~~~~fC~~CG~~~~   52 (645)
T PRK14559          3 ICPQCQFENPNNNRFCQKCGTSLTHK------------------PCP--QCGTEVPVDEAHCPNCGAETG   52 (645)
T ss_pred             cCCCCCCcCCCCCccccccCCCCCCC------------------cCC--CCCCCCCcccccccccCCccc
Confidence            69999999999999999998874310                  599  999999999999999998853


No 11 
>PF12773 DZR:  Double zinc ribbon
Probab=94.59  E-value=0.038  Score=32.01  Aligned_cols=50  Identities=28%  Similarity=0.670  Sum_probs=40.6

Q ss_pred             cCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCccCceeecCCCCCceeccCCccccCCC
Q 033000           54 CTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCK  125 (129)
Q Consensus        54 C~~~~C~~~N~~~~~~C~~C~~~~~~~~~~~~~~~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~  125 (129)
                      |+  .|+..|-.....|..||++-+..                  ....+.|+  .|+..|......|..|+
T Consensus         1 Cp--~Cg~~~~~~~~fC~~CG~~l~~~------------------~~~~~~C~--~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    1 CP--HCGTPNPDDAKFCPHCGTPLPPP------------------DQSKKICP--NCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CC--CcCCcCCccccCChhhcCChhhc------------------cCCCCCCc--CCcCCCcCCcCccCccc
Confidence            66  89999999999999999886511                  13458899  69999999999998885


No 12 
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription]
Probab=93.75  E-value=0.028  Score=42.00  Aligned_cols=29  Identities=28%  Similarity=0.628  Sum_probs=26.2

Q ss_pred             CCCeEcCccCccccccccccccCCCCCCC
Q 033000            5 GGDWMCAACQHQNFKKREACQRCGYPKYG   33 (129)
Q Consensus         5 ~gdW~C~~C~~~Nf~~r~~C~~C~~prp~   33 (129)
                      .|-|.|..|+|.|-+-..+|+.|+.-+..
T Consensus        22 eg~WdCsvCTFrNsAeAfkC~vCdvRKGT   50 (228)
T KOG4477|consen   22 EGKWDCSVCTFRNSAEAFKCFVCDVRKGT   50 (228)
T ss_pred             cCceeeeeeeecchhhhhheeeecccccc
Confidence            47899999999999999999999987654


No 13 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=92.17  E-value=0.067  Score=27.15  Aligned_cols=23  Identities=22%  Similarity=0.599  Sum_probs=20.5

Q ss_pred             eEcCccCccccccccccccCCCC
Q 033000            8 WMCAACQHQNFKKREACQRCGYP   30 (129)
Q Consensus         8 W~C~~C~~~Nf~~r~~C~~C~~p   30 (129)
                      ..|+.|+..+......|..|+++
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCcccCCcCCcccccChhhCCC
Confidence            47999999999999999999875


No 14 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=92.05  E-value=0.081  Score=26.23  Aligned_cols=22  Identities=27%  Similarity=0.768  Sum_probs=19.5

Q ss_pred             EcCccCccccccccccccCCCC
Q 033000            9 MCAACQHQNFKKREACQRCGYP   30 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C~~C~~p   30 (129)
                      .|+.|+..+......|..|+++
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCCc
Confidence            3889999999999999999875


No 15 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=91.42  E-value=0.13  Score=26.11  Aligned_cols=23  Identities=39%  Similarity=0.871  Sum_probs=20.1

Q ss_pred             cccCCCCCCCeecCCCcCccccCCC
Q 033000           52 WYCTAMNCGAHNYASRPNCYRCGAA   76 (129)
Q Consensus        52 W~C~~~~C~~~N~~~~~~C~~C~~~   76 (129)
                      ..|+  .|+..+......|..||++
T Consensus         3 ~~Cp--~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCP--NCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCc--ccCCcCCcccccChhhCCC
Confidence            5788  9999999999999999875


No 16 
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription]
Probab=90.96  E-value=0.097  Score=39.14  Aligned_cols=34  Identities=26%  Similarity=0.623  Sum_probs=28.8

Q ss_pred             CccccCCCcccCCCCCCCeecCCCcCccccCCCCCC
Q 033000           44 RTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTD   79 (129)
Q Consensus        44 ~~~~~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~~~   79 (129)
                      .....+|.|.|.  .|.|+|-+.+-.|+.|+..+..
T Consensus        17 kp~~Deg~WdCs--vCTFrNsAeAfkC~vCdvRKGT   50 (228)
T KOG4477|consen   17 KPNDDEGKWDCS--VCTFRNSAEAFKCFVCDVRKGT   50 (228)
T ss_pred             CCccccCceeee--eeeecchhhhhheeeecccccc
Confidence            445567899999  9999999999999999877644


No 17 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=89.42  E-value=0.22  Score=24.60  Aligned_cols=22  Identities=41%  Similarity=0.942  Sum_probs=18.5

Q ss_pred             ccCCCCCCCeecCCCcCccccCCC
Q 033000           53 YCTAMNCGAHNYASRPNCYRCGAA   76 (129)
Q Consensus        53 ~C~~~~C~~~N~~~~~~C~~C~~~   76 (129)
                      .|+  .|+..+......|..||++
T Consensus         1 ~Cp--~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCP--NCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCc--ccCCCCCCcCcchhhhCCc
Confidence            377  8999998888899999875


No 18 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=87.39  E-value=0.53  Score=41.32  Aligned_cols=48  Identities=27%  Similarity=0.641  Sum_probs=38.8

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCccCceeecCCCCCceeccCCccccCCCCC
Q 033000           53 YCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTP  127 (129)
Q Consensus        53 ~C~~~~C~~~N~~~~~~C~~C~~~~~~~~~~~~~~~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~~p  127 (129)
                      .|+  .|+..|-.....|.+||++-..                   +    .|+  .|+..|-.....|..|+++
T Consensus         3 ~Cp--~Cg~~n~~~akFC~~CG~~l~~-------------------~----~Cp--~CG~~~~~~~~fC~~CG~~   50 (645)
T PRK14559          3 ICP--QCQFENPNNNRFCQKCGTSLTH-------------------K----PCP--QCGTEVPVDEAHCPNCGAE   50 (645)
T ss_pred             cCC--CCCCcCCCCCccccccCCCCCC-------------------C----cCC--CCCCCCCcccccccccCCc
Confidence            588  9999999999999999876321                   0    388  6999999888899999875


No 19 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=85.96  E-value=0.7  Score=24.62  Aligned_cols=25  Identities=32%  Similarity=0.606  Sum_probs=17.7

Q ss_pred             CcccCCCCCCCeecCC--CcCccccCCCC
Q 033000           51 DWYCTAMNCGAHNYAS--RPNCYRCGAAK   77 (129)
Q Consensus        51 dW~C~~~~C~~~N~~~--~~~C~~C~~~~   77 (129)
                      .|+|.  .|+++-...  -..|+.|++++
T Consensus         1 ~~~C~--~CGy~y~~~~~~~~CP~Cg~~~   27 (33)
T cd00350           1 KYVCP--VCGYIYDGEEAPWVCPVCGAPK   27 (33)
T ss_pred             CEECC--CCCCEECCCcCCCcCcCCCCcH
Confidence            38888  888885554  44688887765


No 20 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=84.12  E-value=0.53  Score=27.54  Aligned_cols=24  Identities=29%  Similarity=0.871  Sum_probs=22.0

Q ss_pred             CCeEcCccCccccccccccccCCC
Q 033000            6 GDWMCAACQHQNFKKREACQRCGY   29 (129)
Q Consensus         6 gdW~C~~C~~~Nf~~r~~C~~C~~   29 (129)
                      ..++|-.|+..|....+.|.+|+.
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            457999999999999999999986


No 21 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=83.27  E-value=1.1  Score=24.17  Aligned_cols=26  Identities=35%  Similarity=0.792  Sum_probs=20.2

Q ss_pred             CcccCCCCCCCeecCC--CcCccccCCCCC
Q 033000           51 DWYCTAMNCGAHNYAS--RPNCYRCGAAKT   78 (129)
Q Consensus        51 dW~C~~~~C~~~N~~~--~~~C~~C~~~~~   78 (129)
                      -|.|.  .||++-...  -..|+.|++++.
T Consensus         2 ~~~C~--~CG~i~~g~~~p~~CP~Cg~~~~   29 (34)
T cd00729           2 VWVCP--VCGYIHEGEEAPEKCPICGAPKE   29 (34)
T ss_pred             eEECC--CCCCEeECCcCCCcCcCCCCchH
Confidence            49999  999985543  468999998753


No 22 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=82.05  E-value=2.1  Score=40.35  Aligned_cols=52  Identities=29%  Similarity=0.749  Sum_probs=39.9

Q ss_pred             eEcCccCccccccccccccCCCCCCCCCCCcccccCCccccCCCcccCCCCCCCeecCC---CcCccccCCCCCCc
Q 033000            8 WMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYAS---RPNCYRCGAAKTDY   80 (129)
Q Consensus         8 W~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~---~~~C~~C~~~~~~~   80 (129)
                      =.|+.|+...+.  ..|..|+++...                 .+.|+  .|+...-..   +..|..|+.+-...
T Consensus       668 rkCPkCG~~t~~--~fCP~CGs~te~-----------------vy~CP--sCGaev~~des~a~~CP~CGtplv~~  722 (1337)
T PRK14714        668 RRCPSCGTETYE--NRCPDCGTHTEP-----------------VYVCP--DCGAEVPPDESGRVECPRCDVELTPY  722 (1337)
T ss_pred             EECCCCCCcccc--ccCcccCCcCCC-----------------ceeCc--cCCCccCCCccccccCCCCCCccccc
Confidence            689999998876  499999988421                 45899  999965443   67899999886543


No 23 
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=75.99  E-value=0.54  Score=27.65  Aligned_cols=22  Identities=32%  Similarity=0.988  Sum_probs=19.7

Q ss_pred             EcCccCccccccccccccCCCC
Q 033000            9 MCAACQHQNFKKREACQRCGYP   30 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C~~C~~p   30 (129)
                      +|-.|+..|....++|.+|+.-
T Consensus        16 IC~rC~Arnp~~A~kCRkC~~k   37 (50)
T COG1552          16 ICRRCYARNPPRATKCRKCGYK   37 (50)
T ss_pred             HHHHhcCCCCcchhHHhhccCC
Confidence            6888999999999999999764


No 24 
>KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms]
Probab=75.05  E-value=0.29  Score=43.11  Aligned_cols=75  Identities=12%  Similarity=0.188  Sum_probs=55.8

Q ss_pred             CCCCCCCeEcCccCccccccccccccCCCCCCCCCCCc----------------cc-------------cc---------
Q 033000            1 MSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVS----------------TY-------------LC---------   42 (129)
Q Consensus         1 ~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~----------------~~-------------~~---------   42 (129)
                      |....-.|.|..|.+.|+.....|..|.+.++..+...                ++             .+         
T Consensus         1 ~~~~~~~W~~~~~~~~~lp~al~lS~~~~s~~~~~~l~eDifk~~n~~~~~~~sd~~~~r~v~~~~~~p~f~~s~~~r~~   80 (774)
T KOG4345|consen    1 MPTSAEKWACELCDYMTLPMALVLSDFRRSTGAEPGLAEDIFKGKNWDIHAALSDYEQLRQVHEMNLTPSFCESGQPREI   80 (774)
T ss_pred             CcchhHHHHHHhhccccCchhhHHHHHHhccCCCCCcchhhccCCCccceeecccHHHHHhhhccCCCCcccccCCcccc
Confidence            55556689999999999999999999999988543211                00             00         


Q ss_pred             -CCc-cccCCCcccCCCCCCCeecCCCcCccccCCCC
Q 033000           43 -NRT-EVLAGDWYCTAMNCGAHNYASRPNCYRCGAAK   77 (129)
Q Consensus        43 -~~~-~~~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~   77 (129)
                       .++ .-..-.|.|+  .|...|+++...|.+|-..+
T Consensus        81 ~~~s~~~~~~k~~~~--~~~~lnw~re~R~~~~ls~~  115 (774)
T KOG4345|consen   81 IHKSLIDRNIKWPRP--SLQRLNWPREKRLSRGLSHA  115 (774)
T ss_pred             cccccccccccCCch--HhhhhhHHHHHHHHHHhhcc
Confidence             121 2223579999  99999999999999996554


No 25 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=68.30  E-value=2.9  Score=24.47  Aligned_cols=25  Identities=28%  Similarity=0.639  Sum_probs=22.6

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCC
Q 033000           50 GDWYCTAMNCGAHNYASRPNCYRCGAA   76 (129)
Q Consensus        50 gdW~C~~~~C~~~N~~~~~~C~~C~~~   76 (129)
                      ..++|-  .|+..|-..++.|.+||..
T Consensus        13 ~k~ICr--kC~ARnp~~A~~CRKCg~~   37 (48)
T PRK04136         13 NKKICM--RCNARNPWRATKCRKCGYK   37 (48)
T ss_pred             cccchh--cccCCCCccccccccCCCC
Confidence            468999  9999999999999999963


No 26 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=63.56  E-value=3.4  Score=23.97  Aligned_cols=13  Identities=31%  Similarity=0.976  Sum_probs=7.8

Q ss_pred             CCCCeEcCccCcc
Q 033000            4 PGGDWMCAACQHQ   16 (129)
Q Consensus         4 ~~gdW~C~~C~~~   16 (129)
                      .+.+|.|+.|+..
T Consensus        31 Lp~~w~CP~C~a~   43 (47)
T PF00301_consen   31 LPDDWVCPVCGAP   43 (47)
T ss_dssp             S-TT-B-TTTSSB
T ss_pred             CCCCCcCcCCCCc
Confidence            4789999999764


No 27 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=63.55  E-value=4.2  Score=20.59  Aligned_cols=21  Identities=29%  Similarity=0.857  Sum_probs=15.9

Q ss_pred             EcCccCccccccccccccCCC
Q 033000            9 MCAACQHQNFKKREACQRCGY   29 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C~~C~~   29 (129)
                      .||.|..........|..|+-
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~   22 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGY   22 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCC
Confidence            478888777777778877764


No 28 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=62.81  E-value=4.3  Score=21.86  Aligned_cols=22  Identities=36%  Similarity=1.085  Sum_probs=13.5

Q ss_pred             ccCCCCCCCeecCCCcCccccCCC
Q 033000           53 YCTAMNCGAHNYASRPNCYRCGAA   76 (129)
Q Consensus        53 ~C~~~~C~~~N~~~~~~C~~C~~~   76 (129)
                      .|.  .|+.+-|.-+..|..|+..
T Consensus        13 rC~--~Cg~~~~pPr~~Cp~C~s~   34 (37)
T PF12172_consen   13 RCR--DCGRVQFPPRPVCPHCGSD   34 (37)
T ss_dssp             E-T--TT--EEES--SEETTTT--
T ss_pred             EcC--CCCCEecCCCcCCCCcCcc
Confidence            488  9999999999999999854


No 29 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=60.98  E-value=9.7  Score=36.14  Aligned_cols=50  Identities=28%  Similarity=0.836  Sum_probs=36.3

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCccCceeecCCCCCceeccC---CccccCCCC
Q 033000           50 GDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYAS---RMVCYKCKT  126 (129)
Q Consensus        50 gdW~C~~~~C~~~N~~~~~~C~~C~~~~~~~~~~~~~~~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~---r~~C~~C~~  126 (129)
                      +.-.|+  .|+...+..  .|..||++...                      .+.|+  .|+...-..   +..|..|+.
T Consensus       666 ~~rkCP--kCG~~t~~~--fCP~CGs~te~----------------------vy~CP--sCGaev~~des~a~~CP~CGt  717 (1337)
T PRK14714        666 GRRRCP--SCGTETYEN--RCPDCGTHTEP----------------------VYVCP--DCGAEVPPDESGRVECPRCDV  717 (1337)
T ss_pred             EEEECC--CCCCccccc--cCcccCCcCCC----------------------ceeCc--cCCCccCCCccccccCCCCCC
Confidence            458899  999988764  99999987421                      25788  588864333   567888886


Q ss_pred             C
Q 033000          127 P  127 (129)
Q Consensus       127 p  127 (129)
                      +
T Consensus       718 p  718 (1337)
T PRK14714        718 E  718 (1337)
T ss_pred             c
Confidence            5


No 30 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=59.48  E-value=5.9  Score=29.09  Aligned_cols=26  Identities=35%  Similarity=0.790  Sum_probs=21.5

Q ss_pred             CcccCCCCCCCeecC-CCcCccccCCCCC
Q 033000           51 DWYCTAMNCGAHNYA-SRPNCYRCGAAKT   78 (129)
Q Consensus        51 dW~C~~~~C~~~N~~-~~~~C~~C~~~~~   78 (129)
                      -|+|+  .||++-.. .-..|+.|++|+.
T Consensus       134 ~~vC~--vCGy~~~ge~P~~CPiCga~k~  160 (166)
T COG1592         134 VWVCP--VCGYTHEGEAPEVCPICGAPKE  160 (166)
T ss_pred             EEEcC--CCCCcccCCCCCcCCCCCChHH
Confidence            69999  99998776 4566999999874


No 31 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=57.46  E-value=17  Score=21.90  Aligned_cols=16  Identities=44%  Similarity=1.051  Sum_probs=12.8

Q ss_pred             CccccCCCcccCCCCCCC
Q 033000           44 RTEVLAGDWYCTAMNCGA   61 (129)
Q Consensus        44 ~~~~~~gdW~C~~~~C~~   61 (129)
                      +++.-+.+|.|+  .|+.
T Consensus        29 ~fedlPd~w~CP--~Cg~   44 (55)
T COG1773          29 PFEDLPDDWVCP--ECGV   44 (55)
T ss_pred             chhhCCCccCCC--CCCC
Confidence            567778999999  7765


No 32 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=45.45  E-value=36  Score=20.44  Aligned_cols=23  Identities=26%  Similarity=0.771  Sum_probs=18.9

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCCCC
Q 033000           53 YCTAMNCGAHNYASRPNCYRCGAAKTD   79 (129)
Q Consensus        53 ~C~~~~C~~~N~~~~~~C~~C~~~~~~   79 (129)
                      .|+  .|+...+  ...|..||.+-..
T Consensus         7 ~C~--~CgvYTL--k~~CP~CG~~t~~   29 (56)
T PRK13130          7 KCP--KCGVYTL--KEICPVCGGKTKN   29 (56)
T ss_pred             ECC--CCCCEEc--cccCcCCCCCCCC
Confidence            588  9999888  8899999987543


No 33 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=44.04  E-value=16  Score=19.70  Aligned_cols=32  Identities=25%  Similarity=0.585  Sum_probs=15.2

Q ss_pred             CccccCCCCCCcccccccccCCCCCCCCCCccCceeecCCCCCceec
Q 033000           69 NCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNY  115 (129)
Q Consensus        69 ~C~~C~~~~~~~~~~~~~~~g~~~~~~~~~~~gdW~C~~~~C~~~N~  115 (129)
                      .|..||.+-....+             .+.....+.|+  +|+++.|
T Consensus         2 fC~~CG~~l~~~ip-------------~gd~r~R~vC~--~Cg~IhY   33 (34)
T PF14803_consen    2 FCPQCGGPLERRIP-------------EGDDRERLVCP--ACGFIHY   33 (34)
T ss_dssp             B-TTT--B-EEE---------------TT-SS-EEEET--TTTEEE-
T ss_pred             ccccccChhhhhcC-------------CCCCccceECC--CCCCEEe
Confidence            58888877432211             12234669999  7998865


No 34 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.42  E-value=12  Score=23.36  Aligned_cols=16  Identities=19%  Similarity=0.821  Sum_probs=12.5

Q ss_pred             CCeEcCccCccccccc
Q 033000            6 GDWMCAACQHQNFKKR   21 (129)
Q Consensus         6 gdW~C~~C~~~Nf~~r   21 (129)
                      +-|.|+.|+..||.-.
T Consensus         3 ~~~kCpKCgn~~~~ek   18 (68)
T COG3478           3 NAFKCPKCGNTNYEEK   18 (68)
T ss_pred             ccccCCCcCCcchhhc
Confidence            4577999999998643


No 35 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=43.37  E-value=23  Score=20.74  Aligned_cols=12  Identities=42%  Similarity=1.273  Sum_probs=7.6

Q ss_pred             ccCceeecCCCCCc
Q 033000           99 KSGDWICNRMGCGV  112 (129)
Q Consensus        99 ~~gdW~C~~~~C~~  112 (129)
                      -+.+|.|+  .|+.
T Consensus        31 Lp~~w~CP--~C~a   42 (50)
T cd00730          31 LPDDWVCP--VCGA   42 (50)
T ss_pred             CCCCCCCC--CCCC
Confidence            35677777  5754


No 36 
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=42.05  E-value=14  Score=26.64  Aligned_cols=16  Identities=38%  Similarity=1.126  Sum_probs=12.4

Q ss_pred             CCCCeEcCccCccccc
Q 033000            4 PGGDWMCAACQHQNFK   19 (129)
Q Consensus         4 ~~gdW~C~~C~~~Nf~   19 (129)
                      -+|||.|+.|....-.
T Consensus        15 P~g~W~Cp~C~~~~~~   30 (148)
T cd04718          15 PEGDWICPFCEVEKSG   30 (148)
T ss_pred             CCCCcCCCCCcCCCCC
Confidence            3599999999876544


No 37 
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=39.07  E-value=24  Score=29.85  Aligned_cols=31  Identities=23%  Similarity=0.424  Sum_probs=27.5

Q ss_pred             CCCCCCCeEcCccCccccccccccccCCCCC
Q 033000            1 MSLPGGDWMCAACQHQNFKKREACQRCGYPK   31 (129)
Q Consensus         1 ~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~pr   31 (129)
                      |.+++-.|.|..|++.-..+.-+|..|++=+
T Consensus         1 MaK~~t~f~C~~CG~~s~KW~GkCp~Cg~Wn   31 (456)
T COG1066           1 MAKKKTAFVCQECGYVSPKWLGKCPACGAWN   31 (456)
T ss_pred             CCCcccEEEcccCCCCCccccccCCCCCCcc
Confidence            6677789999999999999999999999744


No 38 
>PRK11823 DNA repair protein RadA; Provisional
Probab=37.69  E-value=28  Score=29.14  Aligned_cols=32  Identities=22%  Similarity=0.452  Sum_probs=27.1

Q ss_pred             CCCCCCCeEcCccCccccccccccccCCCCCC
Q 033000            1 MSLPGGDWMCAACQHQNFKKREACQRCGYPKY   32 (129)
Q Consensus         1 ~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp   32 (129)
                      |.+++-.+.|..|++.-...--+|..|++-..
T Consensus         1 m~~~~~~y~C~~Cg~~~~~~~g~Cp~C~~w~t   32 (446)
T PRK11823          1 MAKKKTAYVCQECGAESPKWLGRCPECGAWNT   32 (446)
T ss_pred             CCCCCCeEECCcCCCCCcccCeeCcCCCCccc
Confidence            66777789999999999999999999987644


No 39 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=34.25  E-value=25  Score=24.21  Aligned_cols=32  Identities=25%  Similarity=0.462  Sum_probs=24.5

Q ss_pred             CCCCCCeEcCccCccc--cccccccccCCCCCCC
Q 033000            2 SLPGGDWMCAACQHQN--FKKREACQRCGYPKYG   33 (129)
Q Consensus         2 ~~~~gdW~C~~C~~~N--f~~r~~C~~C~~prp~   33 (129)
                      |.+--+=+||.|.-.-  ..+...|+.|++|-..
T Consensus        64 Stkav~V~CP~C~K~TKmLGr~D~CM~C~~pLTL   97 (114)
T PF11023_consen   64 STKAVQVECPNCGKQTKMLGRVDACMHCKEPLTL   97 (114)
T ss_pred             cccceeeECCCCCChHhhhchhhccCcCCCcCcc
Confidence            3344456899998776  7888999999998643


No 40 
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=33.39  E-value=28  Score=20.65  Aligned_cols=22  Identities=23%  Similarity=0.733  Sum_probs=14.7

Q ss_pred             eEcCccCcccccccccccc--CCC
Q 033000            8 WMCAACQHQNFKKREACQR--CGY   29 (129)
Q Consensus         8 W~C~~C~~~Nf~~r~~C~~--C~~   29 (129)
                      =+|-.|..+|....+.|.+  |+-
T Consensus        18 ~ICrkCyarl~~~A~nCRKkkCGh   41 (52)
T PF01020_consen   18 MICRKCYARLPPRATNCRKKKCGH   41 (52)
T ss_dssp             EEETTT--EE-TTSSS-TSSSCTS
T ss_pred             eecccccCcCCCCccceecccCCC
Confidence            4788999999999999997  753


No 41 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=32.86  E-value=59  Score=30.52  Aligned_cols=52  Identities=27%  Similarity=0.679  Sum_probs=35.3

Q ss_pred             CCeEcCccCccccccccccccCCCCCCCCCCCcccccCCccccCCCcccCCCCCCCeecCCCcCccccCCCCCCc
Q 033000            6 GDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDY   80 (129)
Q Consensus         6 gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~~~~C~~C~~~~~~~   80 (129)
                      +.=.|+.|+..-  ....|..|++.-.                 .-+.|+  .|+...-  ...|.+|+......
T Consensus       625 g~RfCpsCG~~t--~~frCP~CG~~Te-----------------~i~fCP--~CG~~~~--~y~CPKCG~El~~~  676 (1121)
T PRK04023        625 GRRKCPSCGKET--FYRRCPFCGTHTE-----------------PVYRCP--RCGIEVE--EDECEKCGREPTPY  676 (1121)
T ss_pred             cCccCCCCCCcC--CcccCCCCCCCCC-----------------cceeCc--cccCcCC--CCcCCCCCCCCCcc
Confidence            344688887774  4467888887621                 257899  8977644  35699999886543


No 42 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=32.62  E-value=33  Score=24.21  Aligned_cols=23  Identities=30%  Similarity=0.930  Sum_probs=21.3

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCC
Q 033000           53 YCTAMNCGAHNYASRPNCYRCGAAK   77 (129)
Q Consensus        53 ~C~~~~C~~~N~~~~~~C~~C~~~~   77 (129)
                      .|.  .||.+=|+-+..|..|+.+-
T Consensus        31 kC~--~CG~v~~PPr~~Cp~C~~~~   53 (140)
T COG1545          31 KCK--KCGRVYFPPRAYCPKCGSET   53 (140)
T ss_pred             EcC--CCCeEEcCCcccCCCCCCCC
Confidence            599  99999999999999999883


No 43 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=32.17  E-value=23  Score=19.47  Aligned_cols=15  Identities=27%  Similarity=0.744  Sum_probs=9.7

Q ss_pred             CCeEcCccCcccccc
Q 033000            6 GDWMCAACQHQNFKK   20 (129)
Q Consensus         6 gdW~C~~C~~~Nf~~   20 (129)
                      ..|+|+-|+..|...
T Consensus        23 ~~w~C~~C~~~N~lp   37 (40)
T PF04810_consen   23 KTWICNFCGTKNPLP   37 (40)
T ss_dssp             TEEEETTT--EEE--
T ss_pred             CEEECcCCCCcCCCC
Confidence            489999999988753


No 44 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=31.54  E-value=25  Score=18.69  Aligned_cols=11  Identities=18%  Similarity=0.467  Sum_probs=5.7

Q ss_pred             EcCccCccccc
Q 033000            9 MCAACQHQNFK   19 (129)
Q Consensus         9 ~C~~C~~~Nf~   19 (129)
                      .|+.|+..+..
T Consensus         4 ~CP~C~~~~~v   14 (38)
T TIGR02098         4 QCPNCKTSFRV   14 (38)
T ss_pred             ECCCCCCEEEe
Confidence            45555554443


No 45 
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=28.11  E-value=82  Score=26.66  Aligned_cols=16  Identities=13%  Similarity=0.524  Sum_probs=11.8

Q ss_pred             CccccCCCcccCCCCCCC
Q 033000           44 RTEVLAGDWYCTAMNCGA   61 (129)
Q Consensus        44 ~~~~~~gdW~C~~~~C~~   61 (129)
                      .+.-.+.||.|+  .|+.
T Consensus       451 ~~~~lp~~~~cp--~c~~  466 (479)
T PRK05452        451 PWSEVPDNFLCP--ECSL  466 (479)
T ss_pred             ChhhCCCCCcCc--CCCC
Confidence            466677899999  6654


No 46 
>PHA00626 hypothetical protein
Probab=28.02  E-value=47  Score=20.13  Aligned_cols=11  Identities=27%  Similarity=0.718  Sum_probs=6.5

Q ss_pred             EcCccCccccc
Q 033000            9 MCAACQHQNFK   19 (129)
Q Consensus         9 ~C~~C~~~Nf~   19 (129)
                      .||.|+..|.+
T Consensus         2 ~CP~CGS~~Iv   12 (59)
T PHA00626          2 SCPKCGSGNIA   12 (59)
T ss_pred             CCCCCCCceee
Confidence            36666665554


No 47 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=27.68  E-value=41  Score=23.70  Aligned_cols=23  Identities=30%  Similarity=0.805  Sum_probs=21.4

Q ss_pred             EcCccCccccccccccccCCCCC
Q 033000            9 MCAACQHQNFKKREACQRCGYPK   31 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C~~C~~pr   31 (129)
                      .|..|+..=|..|..|..|+.+-
T Consensus        31 kC~~CG~v~~PPr~~Cp~C~~~~   53 (140)
T COG1545          31 KCKKCGRVYFPPRAYCPKCGSET   53 (140)
T ss_pred             EcCCCCeEEcCCcccCCCCCCCC
Confidence            69999999999999999999983


No 48 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=27.10  E-value=41  Score=18.52  Aligned_cols=12  Identities=33%  Similarity=1.121  Sum_probs=7.1

Q ss_pred             cCceeecCCCCCce
Q 033000          100 SGDWICNRMGCGVH  113 (129)
Q Consensus       100 ~gdW~C~~~~C~~~  113 (129)
                      .|+..|.  .||.+
T Consensus        17 ~g~~vC~--~CG~V   28 (43)
T PF08271_consen   17 RGELVCP--NCGLV   28 (43)
T ss_dssp             TTEEEET--TT-BB
T ss_pred             CCeEECC--CCCCE
Confidence            5667777  47654


No 49 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=26.80  E-value=33  Score=23.58  Aligned_cols=22  Identities=27%  Similarity=0.673  Sum_probs=19.7

Q ss_pred             cCccCccccccccccccCCCCC
Q 033000           10 CAACQHQNFKKREACQRCGYPK   31 (129)
Q Consensus        10 C~~C~~~Nf~~r~~C~~C~~pr   31 (129)
                      ||.|+..=-+.+..|..|++.-
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~i   22 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTEI   22 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCEE
Confidence            8999999999999999999853


No 50 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=25.77  E-value=56  Score=27.47  Aligned_cols=32  Identities=19%  Similarity=0.411  Sum_probs=26.7

Q ss_pred             CCCCCCCeEcCccCccccccccccccCCCCCC
Q 033000            1 MSLPGGDWMCAACQHQNFKKREACQRCGYPKY   32 (129)
Q Consensus         1 ~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp   32 (129)
                      |.++.-.+.|..|++.-...--+|..|++=..
T Consensus         1 m~~~~~~y~C~~Cg~~~~~~~g~Cp~C~~w~t   32 (454)
T TIGR00416         1 MAKAKSKFVCQHCGADSPKWQGKCPACHAWNT   32 (454)
T ss_pred             CCCCCCeEECCcCCCCCccccEECcCCCCccc
Confidence            66666689999999999999999999988544


No 51 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.93  E-value=62  Score=27.56  Aligned_cols=24  Identities=25%  Similarity=0.685  Sum_probs=13.4

Q ss_pred             CcccCCCCCCCeecCCCcCccccCCCC
Q 033000           51 DWYCTAMNCGAHNYASRPNCYRCGAAK   77 (129)
Q Consensus        51 dW~C~~~~C~~~N~~~~~~C~~C~~~~   77 (129)
                      .=.|.  .|++. ..-...|+.|+...
T Consensus       240 ~l~Ch--~Cg~~-~~~~~~Cp~C~s~~  263 (505)
T TIGR00595       240 KLRCH--YCGYQ-EPIPKTCPQCGSED  263 (505)
T ss_pred             eEEcC--CCcCc-CCCCCCCCCCCCCe
Confidence            44566  66644 22335677776654


No 52 
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=23.88  E-value=40  Score=19.31  Aligned_cols=16  Identities=25%  Similarity=0.598  Sum_probs=10.2

Q ss_pred             EcCccCcccccccccc
Q 033000            9 MCAACQHQNFKKREAC   24 (129)
Q Consensus         9 ~C~~C~~~Nf~~r~~C   24 (129)
                      .|+.|+..|=.+...|
T Consensus        13 kCp~CGt~NG~R~~~C   28 (44)
T PF14952_consen   13 KCPKCGTYNGTRGLSC   28 (44)
T ss_pred             cCCcCcCccCcccccc
Confidence            5788888885444444


No 53 
>PRK00420 hypothetical protein; Validated
Probab=23.75  E-value=46  Score=22.84  Aligned_cols=21  Identities=24%  Similarity=0.543  Sum_probs=10.0

Q ss_pred             EcCccCccccc---cccccccCCC
Q 033000            9 MCAACQHQNFK---KREACQRCGY   29 (129)
Q Consensus         9 ~C~~C~~~Nf~---~r~~C~~C~~   29 (129)
                      .||.|++.-|.   ....|..|+.
T Consensus        25 ~CP~Cg~pLf~lk~g~~~Cp~Cg~   48 (112)
T PRK00420         25 HCPVCGLPLFELKDGEVVCPVHGK   48 (112)
T ss_pred             CCCCCCCcceecCCCceECCCCCC
Confidence            35555554442   3444555544


No 54 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=23.64  E-value=57  Score=18.19  Aligned_cols=8  Identities=38%  Similarity=0.924  Sum_probs=3.6

Q ss_pred             CccccCCC
Q 033000           69 NCYRCGAA   76 (129)
Q Consensus        69 ~C~~C~~~   76 (129)
                      .|+.||.+
T Consensus        23 ~Cp~CG~~   30 (46)
T PRK00398         23 RCPYCGYR   30 (46)
T ss_pred             ECCCCCCe
Confidence            34444433


No 55 
>KOG1512 consensus PHD Zn-finger protein [General function prediction only]
Probab=23.44  E-value=37  Score=27.42  Aligned_cols=41  Identities=27%  Similarity=0.711  Sum_probs=26.0

Q ss_pred             CeEcCccCccccccccccccCCCCCCCCCC---------CcccccCCccccCCCcccC
Q 033000            7 DWMCAACQHQNFKKREACQRCGYPKYGGPD---------VSTYLCNRTEVLAGDWYCT   55 (129)
Q Consensus         7 dW~C~~C~~~Nf~~r~~C~~C~~prp~~~~---------~~~~~~~~~~~~~gdW~C~   55 (129)
                      .|.|..|        ..|..|+.|-.....         .-++=-+-..+-.|.|+|+
T Consensus       308 ~W~C~~C--------~lC~IC~~P~~E~E~~FCD~CDRG~HT~CVGL~~lP~G~WICD  357 (381)
T KOG1512|consen  308 FWKCSSC--------ELCRICLGPVIESEHLFCDVCDRGPHTLCVGLQDLPRGEWICD  357 (381)
T ss_pred             chhhccc--------HhhhccCCcccchheeccccccCCCCccccccccccCccchhh
Confidence            5888888        578888888654310         0011114456667999997


No 56 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.78  E-value=45  Score=23.57  Aligned_cols=10  Identities=30%  Similarity=0.952  Sum_probs=5.4

Q ss_pred             cCccccCCCC
Q 033000           68 PNCYRCGAAK   77 (129)
Q Consensus        68 ~~C~~C~~~~   77 (129)
                      .+|..||.|-
T Consensus        29 ~hCp~Cg~PL   38 (131)
T COG1645          29 KHCPKCGTPL   38 (131)
T ss_pred             hhCcccCCcc
Confidence            3455566554


No 57 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=21.68  E-value=52  Score=19.47  Aligned_cols=33  Identities=27%  Similarity=0.494  Sum_probs=19.1

Q ss_pred             ccccccCCCCCCCCCCCcccccCCccccCCCcccCCCCCCCee
Q 033000           21 REACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHN   63 (129)
Q Consensus        21 r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N   63 (129)
                      ..-|.+|...+...+        +.+...-.|.|+  .|++.|
T Consensus        22 aLIC~~C~~hNGla~--------~~~~~~i~y~C~--~Cg~~N   54 (54)
T PF10058_consen   22 ALICSKCFSHNGLAP--------KEEFEEIQYRCP--YCGALN   54 (54)
T ss_pred             eEECcccchhhcccc--------cccCCceEEEcC--CCCCcC
Confidence            344666665544321        123334479999  998876


No 58 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=20.91  E-value=67  Score=16.47  Aligned_cols=10  Identities=50%  Similarity=1.228  Sum_probs=4.3

Q ss_pred             cccccCCCCC
Q 033000           22 EACQRCGYPK   31 (129)
Q Consensus        22 ~~C~~C~~pr   31 (129)
                      ..|.+|++|-
T Consensus         4 rfC~~CG~~t   13 (32)
T PF09297_consen    4 RFCGRCGAPT   13 (32)
T ss_dssp             SB-TTT--BE
T ss_pred             cccCcCCccc
Confidence            4677777763


No 59 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=20.41  E-value=98  Score=16.31  Aligned_cols=7  Identities=43%  Similarity=0.805  Sum_probs=2.6

Q ss_pred             CCCCeec
Q 033000           58 NCGAHNY   64 (129)
Q Consensus        58 ~C~~~N~   64 (129)
                      .|+..|.
T Consensus         5 ~Cg~~~~   11 (32)
T PF03604_consen    5 ECGAEVE   11 (32)
T ss_dssp             SSSSSE-
T ss_pred             cCCCeeE
Confidence            4444443


No 60 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=20.27  E-value=80  Score=28.08  Aligned_cols=25  Identities=32%  Similarity=0.703  Sum_probs=17.7

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCCCC
Q 033000           50 GDWYCTAMNCGAHNYASRPNCYRCGAAKT   78 (129)
Q Consensus        50 gdW~C~~~~C~~~N~~~~~~C~~C~~~~~   78 (129)
                      +.=.|.  .|++.-  ....|..|+....
T Consensus       409 ~~l~Ch--~CG~~~--~p~~Cp~Cgs~~l  433 (665)
T PRK14873        409 GTPRCR--WCGRAA--PDWRCPRCGSDRL  433 (665)
T ss_pred             CeeECC--CCcCCC--cCccCCCCcCCcc
Confidence            456788  888852  4678889987653


Done!