BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033011
         (129 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3R23|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis
 pdb|3R23|B Chain B, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis
 pdb|3R5X|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis Complexed With Atp
 pdb|3R5X|B Chain B, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis Complexed With Atp
 pdb|3R5X|C Chain C, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis Complexed With Atp
 pdb|3R5X|D Chain D, Crystal Structure Of D-Alanine--D-Alanine Ligase From
          Bacillus Anthracis Complexed With Atp
          Length = 307

 Score = 27.7 bits (60), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 22 LEGNALKAIELTEELAQDLLEKNKDLHFDLLSLH 55
          L+ N  + + +T     DL+EK KD+ F LL+LH
Sbjct: 31 LDKNKYEIVPITLNEKXDLIEKAKDIDFALLALH 64


>pdb|4H2H|A Chain A, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|B Chain B, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|C Chain C, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|D Chain D, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|E Chain E, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|F Chain F, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|G Chain G, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
 pdb|4H2H|H Chain H, Crystal Structure Of An Enolase (Mandalate Racemase
           Subgroup, Target Efi-502101) From Pelagibaca Bermudensis
           Htcc2601, With Bound Mg And L-4-Hydroxyproline Betaine
           (Betonicine)
          Length = 376

 Score = 25.4 bits (54), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 1   MKQPANCLEDMEMRKRILHFAL----EGNALKAI 30
           M+QP N  ED+E  + + H AL    +G +L  +
Sbjct: 226 MEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTV 259


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,537,990
Number of Sequences: 62578
Number of extensions: 125187
Number of successful extensions: 414
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 14
length of query: 129
length of database: 14,973,337
effective HSP length: 88
effective length of query: 41
effective length of database: 9,466,473
effective search space: 388125393
effective search space used: 388125393
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)