Query         033045
Match_columns 128
No_of_seqs    68 out of 70
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 09:08:13 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033045.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033045hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00030 S21p ribosomal prote  99.7 1.1E-17 2.3E-22  110.8   6.5   53   39-92      2-55  (58)
  2 PRK00270 rpsU 30S ribosomal pr  99.7 7.1E-17 1.5E-21  108.7   6.9   55   38-93      2-57  (64)
  3 COG0828 RpsU Ribosomal protein  99.7 2.1E-16 4.6E-21  108.8   8.3   61   39-102     3-64  (67)
  4 PF01165 Ribosomal_S21:  Riboso  99.4 1.4E-16   3E-21  103.1  -9.4   55   38-93      1-56  (57)
  5 PF09413 DUF2007:  Domain of un  80.6     1.9   4E-05   27.3   2.6   19   38-56     46-64  (67)
  6 TIGR00756 PPR pentatricopeptid  76.9     1.6 3.4E-05   22.6   1.2   21   42-63     11-31  (35)
  7 PF13812 PPR_3:  Pentatricopept  75.0     2.1 4.5E-05   22.7   1.4   21   42-63     12-32  (34)
  8 cd04937 ACT_AKi-DapG-BS_2 ACT   73.0     1.9 4.2E-05   27.0   1.1   24   35-58     39-62  (64)
  9 PF13840 ACT_7:  ACT domain ; P  73.0     4.5 9.9E-05   26.0   2.8   22   35-56     44-65  (65)
 10 PF00627 UBA:  UBA/TS-N domain;  52.1      12 0.00026   21.7   1.7   13   42-54     25-37  (37)
 11 PF01535 PPR:  PPR repeat;  Int  51.0      12 0.00026   19.1   1.5   20   42-62     11-30  (31)
 12 TIGR03595 Obg_CgtA_exten Obg f  49.6      19 0.00041   24.1   2.6   28   43-70     25-52  (69)
 13 cd04936 ACT_AKii-LysC-BS-like_  48.7      19 0.00041   21.1   2.3   23   36-58     39-61  (63)
 14 PF13041 PPR_2:  PPR repeat fam  48.6      13 0.00027   21.9   1.5   13   43-55     15-27  (50)
 15 COG1570 XseA Exonuclease VII,   43.4      10 0.00022   34.3   0.7   28   41-68    100-127 (440)
 16 PF09269 DUF1967:  Domain of un  42.8      15 0.00032   24.6   1.3   24   47-70     29-52  (69)
 17 cd04923 ACT_AK-LysC-DapG-like_  41.0      30 0.00065   20.2   2.3   24   35-58     38-61  (63)
 18 PRK00286 xseA exodeoxyribonucl  38.3      16 0.00034   31.0   1.1   27   44-70    103-129 (438)
 19 PF08690 GET2:  GET complex sub  37.7      29 0.00062   29.5   2.5   29   78-106     5-33  (302)
 20 cd04917 ACT_AKiii-LysC-EC_2 AC  37.6      33 0.00072   21.1   2.2   22   37-58     41-62  (64)
 21 PF12854 PPR_1:  PPR repeat      37.6      28 0.00061   19.8   1.8   14   43-56     19-32  (34)
 22 PRK12772 bifunctional flagella  37.1      13 0.00028   34.0   0.4   25   75-99    267-291 (609)
 23 cd04916 ACT_AKiii-YclM-BS_2 AC  36.5      36 0.00077   20.3   2.2   23   36-58     42-64  (66)
 24 cd04892 ACT_AK-like_2 ACT doma  36.4      38 0.00082   19.3   2.2   23   36-58     41-63  (65)
 25 TIGR01404 FlhB_rel_III type II  35.6      16 0.00034   31.2   0.6   25   75-99      5-29  (342)
 26 TIGR00237 xseA exodeoxyribonuc  35.4      16 0.00035   31.6   0.7   27   43-69     96-122 (432)
 27 cd04915 ACT_AK-Ectoine_2 ACT d  35.0      39 0.00084   21.6   2.3   22   37-58     43-64  (66)
 28 PRK12332 tsf elongation factor  34.9      30 0.00066   27.6   2.1   15   43-57     29-43  (198)
 29 PF06506 PrpR_N:  Propionate ca  34.8      49  0.0011   24.6   3.1   25   38-62     10-34  (176)
 30 PRK09377 tsf elongation factor  34.4      30 0.00064   29.3   2.1   15   43-57     30-44  (290)
 31 TIGR00116 tsf translation elon  33.6      31 0.00068   29.2   2.1   15   43-57     29-43  (290)
 32 cd00194 UBA Ubiquitin Associat  33.2      34 0.00075   19.3   1.6   13   42-54     24-36  (38)
 33 cd04919 ACT_AK-Hom3_2 ACT doma  32.5      46 0.00099   20.1   2.2   23   36-58     42-64  (66)
 34 PF07338 DUF1471:  Protein of u  32.3      91   0.002   20.1   3.7   32   31-62      1-32  (56)
 35 cd02684 MIT_2 MIT: domain cont  32.3 1.6E+02  0.0035   19.8   7.1   47   45-98     20-67  (75)
 36 cd04920 ACT_AKiii-DAPDC_2 ACT   31.6      48   0.001   20.9   2.3   22   37-58     40-61  (63)
 37 PF01312 Bac_export_2:  FlhB Hr  31.5      16 0.00034   31.0   0.0   25   75-99      7-31  (343)
 38 PRK06298 type III secretion sy  30.8      21 0.00045   30.8   0.6   25   75-99      6-30  (356)
 39 PRK13109 flhB flagellar biosyn  30.5      20 0.00043   31.0   0.5   25   75-99     12-36  (358)
 40 cd04922 ACT_AKi-HSDH-ThrA_2 AC  30.3      53  0.0011   19.5   2.2   23   36-58     42-64  (66)
 41 cd04924 ACT_AK-Arch_2 ACT doma  29.9      52  0.0011   19.5   2.1   23   36-58     42-64  (66)
 42 CHL00098 tsf elongation factor  29.8      41  0.0009   27.0   2.1   15   43-57     26-40  (200)
 43 PRK05702 flhB flagellar biosyn  29.5      22 0.00049   30.6   0.6   25   75-99     11-35  (359)
 44 TIGR00328 flhB flagellar biosy  29.3      22 0.00047   30.6   0.5   25   75-99      4-28  (347)
 45 PRK09108 type III secretion sy  29.0      22 0.00048   30.6   0.5   25   75-99      7-31  (353)
 46 PRK08156 type III secretion sy  28.8      24 0.00052   30.7   0.6   25   75-99      6-30  (361)
 47 cd04918 ACT_AK1-AT_2 ACT domai  28.6      57  0.0012   20.5   2.2   22   37-58     42-63  (65)
 48 PRK12721 secretion system appa  28.0      25 0.00055   30.2   0.7   25   75-99      6-30  (349)
 49 PRK12468 flhB flagellar biosyn  27.9      25 0.00053   30.8   0.6   25   75-99     11-35  (386)
 50 smart00165 UBA Ubiquitin assoc  26.7      51  0.0011   18.6   1.6   12   43-54     25-36  (37)
 51 COG1377 FlhB Flagellar biosynt  25.7      30 0.00066   30.5   0.8   25   75-99     11-35  (363)
 52 COG3763 Uncharacterized protei  25.6      38 0.00083   24.1   1.1   22   61-84     41-62  (71)
 53 PRK01844 hypothetical protein;  23.7      44 0.00096   23.7   1.1   24   61-86     41-64  (72)
 54 PRK00523 hypothetical protein;  23.6      45 0.00097   23.7   1.1   23   61-85     42-64  (72)
 55 COG3603 Uncharacterized conser  23.4      65  0.0014   25.2   2.1   17   39-55    104-120 (128)
 56 PF00486 Trans_reg_C:  Transcri  23.1      43 0.00092   20.7   0.9   22   41-62     40-61  (77)
 57 PF07721 TPR_4:  Tetratricopept  22.8      57  0.0012   17.4   1.2   14   42-55     12-25  (26)
 58 smart00668 CTLH C-terminal to   22.7      55  0.0012   19.4   1.3   16   41-56     11-26  (58)
 59 PF07660 STN:  Secretin and Ton  22.6      76  0.0016   18.9   1.9   25   30-54      8-32  (52)
 60 PF09125 COX2-transmemb:  Cytoc  22.5 1.1E+02  0.0023   19.7   2.5   19  108-126    12-30  (38)
 61 PF03197 FRD2:  Bacteriophage F  22.3 1.1E+02  0.0024   23.1   3.0   21   37-57     79-99  (102)
 62 cd06337 PBP1_ABC_ligand_bindin  22.3      93   0.002   24.8   2.8   28   36-63     41-70  (357)
 63 PF13176 TPR_7:  Tetratricopept  22.1 1.1E+02  0.0024   17.1   2.5   14   43-56     11-24  (36)
 64 PF13428 TPR_14:  Tetratricopep  22.0   1E+02  0.0022   17.7   2.3   19   43-61     13-31  (44)
 65 COG0264 Tsf Translation elonga  22.0      66  0.0014   27.9   2.1   15   43-57     30-44  (296)
 66 PRK10564 maltose regulon perip  21.3      47   0.001   28.8   1.1   21   36-56    262-282 (303)
 67 COG4080 SpoU rRNA Methylase fa  21.1      50  0.0011   26.3   1.1   26   30-56     46-74  (147)
 68 PF13181 TPR_8:  Tetratricopept  20.5   1E+02  0.0022   16.1   2.0   16   44-59     14-29  (34)
 69 PRK08178 acetolactate synthase  20.4 1.2E+02  0.0027   22.1   2.9   50    4-56     21-71  (96)
 70 PF02845 CUE:  CUE domain;  Int  20.2      84  0.0018   18.6   1.7   12   43-54     27-38  (42)
 71 PF11823 DUF3343:  Protein of u  20.1 1.3E+02  0.0027   19.6   2.7   21   36-56     41-61  (73)
 72 PF14626 RNase_Zc3h12a_2:  Zc3h  20.1      36 0.00079   26.3   0.1    9   72-80    100-108 (122)

No 1  
>TIGR00030 S21p ribosomal protein S21. This model describes bacterial ribosomal protein S21 and most mitochondrial and chloroplast equivalents.
Probab=99.72  E-value=1.1e-17  Score=110.84  Aligned_cols=53  Identities=34%  Similarity=0.483  Sum_probs=46.9

Q ss_pred             EEEEecCC-HHHHHHHHHHHHhhhhHHHHHHHHHhhccCCcHHHHHHHHHHHHHH
Q 033045           39 RVKVFNGN-LEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKI   92 (128)
Q Consensus        39 ~V~VrDnN-vEqALrvLKrKMq~eGifRemK~r~~~yeKPSEKR~raRk~~err~   92 (128)
                      +|.|.||+ +|+||+.+|++++++||++||+.|+ |||||||+|.++..++.+++
T Consensus         2 ~V~V~~~e~ie~alrrfkr~~~~~gil~e~r~r~-~yeKPs~krkrk~~~a~rr~   55 (58)
T TIGR00030         2 TVKVKEGESIDSALRRFKRKLEKEGILRELKKRR-YYEKPSERRRRKEKAAAKRI   55 (58)
T ss_pred             eeEeCCCCcHHHHHHHHHHHHHHcchHHHHHHHH-hhcCHHHHHHHHHHHHHHHH
Confidence            59999999 9999999999999999999999995 99999999976665555544


No 2  
>PRK00270 rpsU 30S ribosomal protein S21; Reviewed
Probab=99.69  E-value=7.1e-17  Score=108.68  Aligned_cols=55  Identities=31%  Similarity=0.441  Sum_probs=47.6

Q ss_pred             eEEEEecCC-HHHHHHHHHHHHhhhhHHHHHHHHHhhccCCcHHHHHHHHHHHHHHh
Q 033045           38 IRVKVFNGN-LEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIR   93 (128)
Q Consensus        38 I~V~VrDnN-vEqALrvLKrKMq~eGifRemK~r~~~yeKPSEKR~raRk~~err~R   93 (128)
                      +.|.|.||| +|+||+.+|++++++||++|++.++ |||||||+|.++..++.++.+
T Consensus         2 ~~V~V~~~e~ie~Alrrfkr~~~k~gil~e~r~r~-~yekPs~krkrk~~~a~rr~~   57 (64)
T PRK00270          2 PQVKVRENESIDKALRRFKRKVEKAGILRELRRRE-FYEKPSEKRKRKKAAARKRRR   57 (64)
T ss_pred             CeeEeCCCChHHHHHHHHHHHHHHcchHHHHHHHH-hhcCHHHHHHHHHHHHHHHHH
Confidence            469999999 9999999999999999999999985 999999999766555555543


No 3  
>COG0828 RpsU Ribosomal protein S21 [Translation, ribosomal structure and biogenesis]
Probab=99.68  E-value=2.1e-16  Score=108.85  Aligned_cols=61  Identities=36%  Similarity=0.437  Sum_probs=55.0

Q ss_pred             EEEEecCC-HHHHHHHHHHHHhhhhHHHHHHHHHhhccCCcHHHHHHHHHHHHHHhhHHHHHHHH
Q 033045           39 RVKVFNGN-LEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIRSQDLARKLK  102 (128)
Q Consensus        39 ~V~VrDnN-vEqALrvLKrKMq~eGifRemK~r~~~yeKPSEKR~raRk~~err~Rs~elarKLk  102 (128)
                      +|.|++|| +|+||+.+|++++.+||++|++.|. ||||||+++  ++++++++.|..+.+.+.+
T Consensus         3 ~v~V~ene~~d~ALrrFKr~~~k~gil~e~k~r~-~yEkPs~kr--krK~a~a~kr~~k~~~k~~   64 (67)
T COG0828           3 QVKVRENEPLDKALRRFKRKVEKEGILREMKERE-FYEKPSEKR--KRKKAAARKRKFKRLRKEQ   64 (67)
T ss_pred             eeeecCCChHHHHHHHHHHHHHHHHHHHHHHHHH-hccCchHHH--HHHHHHHHHHHHHHHHHHh
Confidence            59999999 9999999999999999999999995 999999999  6888888888887776654


No 4  
>PF01165 Ribosomal_S21:  Ribosomal protein S21;  InterPro: IPR001911 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Evidence suggests that, in prokaryotes, the peptidyl transferase reaction is performed by the large subunit 23S rRNA, whereas proteins probably have a greater role in eukaryote ribosomes. Most of the proteins lie close to, or on the surface of, the 30S subunit, arranged peripherally around the rRNA []. The small subunit ribosomal proteins can be categorised as primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S21 contains 55-70 amino acid residues, and has only been found in eubacteria to date, though it has been reported that plant chloroplasts and mammalian mitochondria contain ribosomal subunit protein S21. Experimental evidence has revealed that S21 is well exposed on the surface of the Escherichia coli ribosome [], and is one of the 'split proteins': these are a discrete group that are selectively removed from 30S subunits under low salt conditions and are required for the formation of activated 30S reconstitution intermediate (RI*) particles.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2VHO_U 3J18_U 2AVY_U 3OFO_U 3OFP_U 2WWL_U 3J0X_X 3IZV_Y 3ORA_U 3IZW_Y ....
Probab=99.44  E-value=1.4e-16  Score=103.06  Aligned_cols=55  Identities=33%  Similarity=0.433  Sum_probs=45.3

Q ss_pred             eEEEEecCC-HHHHHHHHHHHHhhhhHHHHHHHHHhhccCCcHHHHHHHHHHHHHHh
Q 033045           38 IRVKVFNGN-LEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIR   93 (128)
Q Consensus        38 I~V~VrDnN-vEqALrvLKrKMq~eGifRemK~r~~~yeKPSEKR~raRk~~err~R   93 (128)
                      |.|.|.||+ +|+||+.|+++|+++||.++++.++ |||||||+|.++++++.+++.
T Consensus         1 v~V~V~~~~~~e~Alrr~~r~~~~~gi~~~~r~r~-~yekps~kRkrk~~~~~rr~~   56 (57)
T PF01165_consen    1 VTVKVRDGEDVERALRRFKRKVRRNGILKELRKRR-FYEKPSEKRKRKRSERWRRRF   56 (57)
T ss_dssp             ---EEESSSSSSSSSGTTCCTSSTTHHHTTTSSSB--SSSCCCCTTHCCCCCTHHHH
T ss_pred             CeeecCCCCCHHHHHHHHHHHHHHcChHHHHHHHH-hcCCHHHHHHHHHHHHHHHHh
Confidence            569999887 9999999999999999999999985 999999999877766666543


No 5  
>PF09413 DUF2007:  Domain of unknown function (DUF2007);  InterPro: IPR018551  This is a family of proteins with unknown function. ; PDB: 2HFV_A.
Probab=80.62  E-value=1.9  Score=27.34  Aligned_cols=19  Identities=21%  Similarity=0.270  Sum_probs=17.3

Q ss_pred             eEEEEecCCHHHHHHHHHH
Q 033045           38 IRVKVFNGNLEQALSWMQR   56 (128)
Q Consensus        38 I~V~VrDnNvEqALrvLKr   56 (128)
                      ++|.|.+.|+|+|..+|+.
T Consensus        46 ~~v~V~~~d~~~A~~il~~   64 (67)
T PF09413_consen   46 VEVYVPEEDYERAREILEE   64 (67)
T ss_dssp             EEEEEEGGGHHHHHHHHHH
T ss_pred             eEEEECHHHHHHHHHHHHH
Confidence            8899999999999999863


No 6  
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=76.89  E-value=1.6  Score=22.65  Aligned_cols=21  Identities=33%  Similarity=0.526  Sum_probs=15.8

Q ss_pred             EecCCHHHHHHHHHHHHhhhhH
Q 033045           42 VFNGNLEQALSWMQRKMQSSGI   63 (128)
Q Consensus        42 VrDnNvEqALrvLKrKMq~eGi   63 (128)
                      ++.|++++|+.++.+ |.++|+
T Consensus        11 ~~~~~~~~a~~~~~~-M~~~g~   31 (35)
T TIGR00756        11 CKAGRVEEALELFKE-MLERGI   31 (35)
T ss_pred             HHCCCHHHHHHHHHH-HHHcCC
Confidence            457899999998864 666654


No 7  
>PF13812 PPR_3:  Pentatricopeptide repeat domain
Probab=74.95  E-value=2.1  Score=22.70  Aligned_cols=21  Identities=24%  Similarity=0.480  Sum_probs=15.4

Q ss_pred             EecCCHHHHHHHHHHHHhhhhH
Q 033045           42 VFNGNLEQALSWMQRKMQSSGI   63 (128)
Q Consensus        42 VrDnNvEqALrvLKrKMq~eGi   63 (128)
                      +..|++|.|+.++.. |++.||
T Consensus        12 ~~~g~~~~a~~~~~~-M~~~gv   32 (34)
T PF13812_consen   12 AKAGDPDAALQLFDE-MKEQGV   32 (34)
T ss_pred             HHCCCHHHHHHHHHH-HHHhCC
Confidence            457899999988865 655654


No 8  
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI. This CD includes the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) strain 168), Clostridia, and Actinobacteria bacterial species. In B. subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive AK isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The BS AKI is tetrameric consisting of two alpha and two beta subunits; th
Probab=72.99  E-value=1.9  Score=27.02  Aligned_cols=24  Identities=13%  Similarity=0.213  Sum_probs=20.2

Q ss_pred             ccceEEEEecCCHHHHHHHHHHHH
Q 033045           35 WRGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        35 ~rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ...|.+.|.++|.++|++.|.+-+
T Consensus        39 e~~is~~v~~~~~~~av~~Lh~~f   62 (64)
T cd04937          39 HTTISCLVSEDDVKEAVNALHEAF   62 (64)
T ss_pred             ccEEEEEEcHHHHHHHHHHHHHHh
Confidence            446778999999999999998754


No 9  
>PF13840 ACT_7:  ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D.
Probab=72.97  E-value=4.5  Score=26.04  Aligned_cols=22  Identities=23%  Similarity=0.232  Sum_probs=19.1

Q ss_pred             ccceEEEEecCCHHHHHHHHHH
Q 033045           35 WRGIRVKVFNGNLEQALSWMQR   56 (128)
Q Consensus        35 ~rgI~V~VrDnNvEqALrvLKr   56 (128)
                      ...+.+.|.+.++|+|+++|++
T Consensus        44 ~~~~~ilV~~~~~~~A~~~L~~   65 (65)
T PF13840_consen   44 EISISILVKEEDLEKAVEALHE   65 (65)
T ss_dssp             SSEEEEEEEGGGHHHHHHHHHH
T ss_pred             eeeEEEEEeHHHHHHHHHHhcC
Confidence            3567899999999999999975


No 10 
>PF00627 UBA:  UBA/TS-N domain;  InterPro: IPR000449  UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases []. The human homologue of yeast Rad23A is one example of a nucleotide excision-repair protein that contains both an internal and a C-terminal UBA domain. The solution structure of human Rad23A UBA(2) showed that the domain forms a compact three-helix bundle []. Comparison of the structures of UBA(1) and UBA(2) reveals that both form very similar folds and have a conserved large hydrophobic surface patch which may be a common protein-interacting surface present in diverse UBA domains. Evidence that ubiquitin binds to UBA domains leads to the prediction that the hydrophobic surface patch of UBA domains interacts with the hydrophobic surface on the five-stranded beta-sheet of ubiquitin []. This domain is similar in sequence to the N-terminal domain of translation elongation factor EF1B (or EF-Ts) from bacteria, mitochondria and chloroplasts. More information about EF1B (EF-Ts) proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0005515 protein binding; PDB: 2DAI_A 2OO9_C 2JUJ_A 1WHC_A 1YLA_A 2O25_B 3K9O_A 3K9P_A 3F92_A 3E46_A ....
Probab=52.07  E-value=12  Score=21.74  Aligned_cols=13  Identities=46%  Similarity=1.078  Sum_probs=10.4

Q ss_pred             EecCCHHHHHHHH
Q 033045           42 VFNGNLEQALSWM   54 (128)
Q Consensus        42 VrDnNvEqALrvL   54 (128)
                      -.+||+|.|+..|
T Consensus        25 ~~~~nve~A~~~L   37 (37)
T PF00627_consen   25 ACNGNVERAVDWL   37 (37)
T ss_dssp             HTTTSHHHHHHHH
T ss_pred             HcCCCHHHHHHhC
Confidence            3578999999876


No 11 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=51.01  E-value=12  Score=19.14  Aligned_cols=20  Identities=30%  Similarity=0.488  Sum_probs=14.6

Q ss_pred             EecCCHHHHHHHHHHHHhhhh
Q 033045           42 VFNGNLEQALSWMQRKMQSSG   62 (128)
Q Consensus        42 VrDnNvEqALrvLKrKMq~eG   62 (128)
                      ...|++|+|+++++ +|.+.|
T Consensus        11 ~~~~~~~~a~~~~~-~M~~~g   30 (31)
T PF01535_consen   11 CKMGQFEEALEVFD-EMRERG   30 (31)
T ss_pred             HccchHHHHHHHHH-HHhHCc
Confidence            45689999999885 455555


No 12 
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=49.64  E-value=19  Score=24.12  Aligned_cols=28  Identities=21%  Similarity=0.363  Sum_probs=23.9

Q ss_pred             ecCCHHHHHHHHHHHHhhhhHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRKMQSSGIERLIKRE   70 (128)
Q Consensus        43 rDnNvEqALrvLKrKMq~eGifRemK~r   70 (128)
                      .|=|-+.|++-+.++|++.||...|+..
T Consensus        25 ~~~~~~e~~~~f~~~L~~~Gv~~~L~~~   52 (69)
T TIGR03595        25 TPFNNDENLRRFARKLKKLGVEDALRKA   52 (69)
T ss_pred             cCCCCHHHHHHHHHHHHHCCHHHHHHHc
Confidence            3445678999999999999999999876


No 13 
>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis strain 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive AK isoenzymes. The B. subtilis strain 168 AKII is induced by methionine and repressed and inhibited by lysine. Although C. glutamicum is known to contain a single AK, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In corynebacteria and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regu
Probab=48.73  E-value=19  Score=21.06  Aligned_cols=23  Identities=13%  Similarity=0.146  Sum_probs=20.2

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ..+.+.|.+.|+++|+++|.+.+
T Consensus        39 ~~is~~v~~~d~~~~~~~l~~~~   61 (63)
T cd04936          39 IKISCLIDEDDAEKAVRALHEAF   61 (63)
T ss_pred             ceEEEEEeHHHHHHHHHHHHHHh
Confidence            55779999999999999998865


No 14 
>PF13041 PPR_2:  PPR repeat family 
Probab=48.60  E-value=13  Score=21.94  Aligned_cols=13  Identities=31%  Similarity=0.514  Sum_probs=10.2

Q ss_pred             ecCCHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQ   55 (128)
Q Consensus        43 rDnNvEqALrvLK   55 (128)
                      +.|++|+|+++++
T Consensus        15 ~~~~~~~a~~l~~   27 (50)
T PF13041_consen   15 KAGKFEEALKLFK   27 (50)
T ss_pred             HCcCHHHHHHHHH
Confidence            4689999998764


No 15 
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair]
Probab=43.40  E-value=10  Score=34.26  Aligned_cols=28  Identities=18%  Similarity=0.156  Sum_probs=23.8

Q ss_pred             EEecCCHHHHHHHHHHHHhhhhHHHHHH
Q 033045           41 KVFNGNLEQALSWMQRKMQSSGIERLIK   68 (128)
Q Consensus        41 ~VrDnNvEqALrvLKrKMq~eGifRemK   68 (128)
                      -.-.|++-+++.-||+|++.||+|.+=.
T Consensus       100 p~G~G~L~~~~E~lK~kL~aEGlFd~~~  127 (440)
T COG1570         100 PAGLGALYLAFEQLKAKLAAEGLFDPER  127 (440)
T ss_pred             cCChhHHHHHHHHHHHHHHhCCCcChhh
Confidence            3456899999999999999999996643


No 16 
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=42.83  E-value=15  Score=24.56  Aligned_cols=24  Identities=29%  Similarity=0.595  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHhhhhHHHHHHHH
Q 033045           47 LEQALSWMQRKMQSSGIERLIKRE   70 (128)
Q Consensus        47 vEqALrvLKrKMq~eGifRemK~r   70 (128)
                      -+.|++-+.++|.+.||...|+..
T Consensus        29 ~~e~~~rf~~~L~~~Gv~~~L~~~   52 (69)
T PF09269_consen   29 DEESLRRFQRKLKKMGVEKALRKA   52 (69)
T ss_dssp             TGGGHHHHHHHHHHTTHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHCCHHHHHHHc
Confidence            457899999999999999999865


No 17 
>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, as well as, the second and fourth, of four, ACT domains present in cyanobacteria AK. Also included are the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase isoenzyme AKI found in Bacilli (B. subtilis strain 168), Clostridia, and Actinobacteria bacterial species. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=41.02  E-value=30  Score=20.20  Aligned_cols=24  Identities=17%  Similarity=0.084  Sum_probs=20.4

Q ss_pred             ccceEEEEecCCHHHHHHHHHHHH
Q 033045           35 WRGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        35 ~rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ...+.+.|.+.|+++|+++|.+.+
T Consensus        38 ~~~is~~v~~~~~~~~~~~l~~~l   61 (63)
T cd04923          38 EIKISCLVDEDDAEKAVRALHEAF   61 (63)
T ss_pred             CCeEEEEEeHHHHHHHHHHHHHHh
Confidence            355789999999999999998765


No 18 
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=38.29  E-value=16  Score=31.03  Aligned_cols=27  Identities=19%  Similarity=0.345  Sum_probs=23.1

Q ss_pred             cCCHHHHHHHHHHHHhhhhHHHHHHHH
Q 033045           44 NGNLEQALSWMQRKMQSSGIERLIKRE   70 (128)
Q Consensus        44 DnNvEqALrvLKrKMq~eGifRemK~r   70 (128)
                      -|++.+++.-||+|+..||+|..-+.+
T Consensus       103 ~G~l~~~~~~lk~~L~~eGlfd~~~k~  129 (438)
T PRK00286        103 IGALAAAFEQLKEKLAAEGLFDPERKK  129 (438)
T ss_pred             ccHHHHHHHHHHHHHHHCCCCChhhcC
Confidence            399999999999999999999765433


No 19 
>PF08690 GET2:  GET complex subunit GET2;  InterPro: IPR014802 This family corresponds to the GET complex subunit GET2. The GET complex is involved in the retrieval of ER resident proteins from the Golgi []. ; PDB: 3SJD_D 3ZS9_C.
Probab=37.74  E-value=29  Score=29.46  Aligned_cols=29  Identities=34%  Similarity=0.425  Sum_probs=20.7

Q ss_pred             cHHHHHHHHHHHHHHhhHHHHHHHHHHHH
Q 033045           78 SEKRVLARKNLERKIRSQDLARKLKAILV  106 (128)
Q Consensus        78 SEKR~raRk~~err~Rs~elarKLk~Ili  106 (128)
                      +|||.+.|+.+|+++..=.-..+|..|+-
T Consensus         5 aEkrRLrRERReAKi~~GgaSaRLnKITg   33 (302)
T PF08690_consen    5 AEKRRLRRERREAKIKAGGASARLNKITG   33 (302)
T ss_dssp             HHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCcHHHHHHHhc
Confidence            58888888777777754444567888875


No 20 
>cd04917 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The E. coli AKIII (LysC) binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The second ACT domain (ACT2), this CD, is not involved in the binding of heterotrophic effectors. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=37.63  E-value=33  Score=21.12  Aligned_cols=22  Identities=5%  Similarity=0.206  Sum_probs=18.5

Q ss_pred             ceEEEEecCCHHHHHHHHHHHH
Q 033045           37 GIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        37 gI~V~VrDnNvEqALrvLKrKM   58 (128)
                      -|.+.|.+.|.++|++.|.+.+
T Consensus        41 ~is~~V~~~~~~~a~~~Lh~~f   62 (64)
T cd04917          41 NLCFLVKEEDKDEVVQRLHSRL   62 (64)
T ss_pred             EEEEEEeHHHHHHHHHHHHHHH
Confidence            4667999999999999998754


No 21 
>PF12854 PPR_1:  PPR repeat
Probab=37.60  E-value=28  Score=19.77  Aligned_cols=14  Identities=14%  Similarity=0.389  Sum_probs=11.5

Q ss_pred             ecCCHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQR   56 (128)
Q Consensus        43 rDnNvEqALrvLKr   56 (128)
                      +.|++|.|++++.+
T Consensus        19 k~G~~~~A~~l~~~   32 (34)
T PF12854_consen   19 KAGRVDEAFELFDE   32 (34)
T ss_pred             HCCCHHHHHHHHHh
Confidence            56999999998853


No 22 
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional
Probab=37.06  E-value=13  Score=34.00  Aligned_cols=25  Identities=16%  Similarity=0.174  Sum_probs=20.4

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.++.++.=+.-+|+|+..
T Consensus       267 E~pT~krl~~ARekGqV~kS~El~~  291 (609)
T PRK12772        267 EEATPKKKSDARKKGQIAKSKELAL  291 (609)
T ss_pred             CCCChhHHHHHHhcCCCCchHHHHH
Confidence            9999999776666667889999764


No 23 
>cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. B. subtilis YclM is reported to be a single polypeptide of 50 kD. AKIII from B. subtilis strain 168 is induced by lysine and repressed by threonine and it is synergistically inhibited by lysine and threonine. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=36.46  E-value=36  Score=20.30  Aligned_cols=23  Identities=17%  Similarity=0.270  Sum_probs=19.9

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ..+.+.|.+.|++.|+.+|.+.+
T Consensus        42 ~~isf~v~~~d~~~~~~~lh~~~   64 (66)
T cd04916          42 ISIMIGVHNEDADKAVKAIYEEF   64 (66)
T ss_pred             cEEEEEEeHHHHHHHHHHHHHHH
Confidence            55779999999999999998765


No 24 
>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). This CD includes the second of two ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). The exception in this group, is the inclusion of the first ACT domain of the bifunctional  aspartokinase - homoserine dehydrogenase-like enzyme group (ACT_AKi-HSDH-ThrA-like_1) which includes the  monofunctional,  threonine-sensitive, aspartokinase found  in Methanococcus jannaschii and other related archaeal species. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. AK is the first enzyme in the pathway of the biosynthesis of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. One mechanism for the regulation of this pathway is by the production of several isoenzymes of AK with different repressors an
Probab=36.42  E-value=38  Score=19.27  Aligned_cols=23  Identities=13%  Similarity=0.199  Sum_probs=19.8

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ..+.+.|.+.|++.+++.|.+.+
T Consensus        41 ~~i~~~v~~~~~~~~~~~l~~~~   63 (65)
T cd04892          41 VNISFVVDEDDADKAVKALHEEF   63 (65)
T ss_pred             eeEEEEEeHHHHHHHHHHHHHHH
Confidence            55778999999999999998765


No 25 
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family. This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FlhB (TIGRFAMs model TIGR00328). This model may not identify all type III secretion system FlhB homologs.
Probab=35.56  E-value=16  Score=31.23  Aligned_cols=25  Identities=20%  Similarity=0.272  Sum_probs=20.3

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=+.-+|+|+..
T Consensus         5 E~pT~kKL~dARekGqV~kS~el~~   29 (342)
T TIGR01404         5 EKPTPKKLRDARKKGQVAKSKDLTS   29 (342)
T ss_pred             CCCChhHHHHHHHcCCCcccHhHHH
Confidence            8999999766666667889999765


No 26 
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits.
Probab=35.42  E-value=16  Score=31.63  Aligned_cols=27  Identities=19%  Similarity=0.207  Sum_probs=22.9

Q ss_pred             ecCCHHHHHHHHHHHHhhhhHHHHHHH
Q 033045           43 FNGNLEQALSWMQRKMQSSGIERLIKR   69 (128)
Q Consensus        43 rDnNvEqALrvLKrKMq~eGifRemK~   69 (128)
                      .-|++..++.-||+|+..||+|..=+.
T Consensus        96 G~G~l~~~~~~lk~~L~~eGlfd~~~k  122 (432)
T TIGR00237        96 GEGLLQLAYEQLKEKLAAEGLFDQEYK  122 (432)
T ss_pred             ChHHHHHHHHHHHHHHHHCCCCCchhc
Confidence            358999999999999999999965433


No 27 
>cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and various other halotolerant or halophilic bacteria. Bacteria exposed to hyperosmotic stress accumulate organic solutes called 'compatible solutes'  of which ectoine, a heterocyclic amino acid, is one. Apart from its osmotic function, ectoine also exhibits a protective effect on proteins, nucleic acids and membranes against a variety of stress factors. de novo synthesis of ectoine starts with the phosphorylation of L-aspartate and shares its first two enzymatic steps with the biosynthesis of amino acids of the aspartate family: aspartokinas
Probab=35.04  E-value=39  Score=21.60  Aligned_cols=22  Identities=9%  Similarity=0.237  Sum_probs=18.9

Q ss_pred             ceEEEEecCCHHHHHHHHHHHH
Q 033045           37 GIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        37 gI~V~VrDnNvEqALrvLKrKM   58 (128)
                      -|.+.|.+.|.++|++.|.+.+
T Consensus        43 ~is~~V~~~~~~~av~~Lh~~f   64 (66)
T cd04915          43 DVQFVVDRDDYDNAIKALHAAL   64 (66)
T ss_pred             EEEEEEEHHHHHHHHHHHHHHH
Confidence            5778999999999999997754


No 28 
>PRK12332 tsf elongation factor Ts; Reviewed
Probab=34.93  E-value=30  Score=27.63  Aligned_cols=15  Identities=40%  Similarity=1.015  Sum_probs=13.4

Q ss_pred             ecCCHHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRK   57 (128)
Q Consensus        43 rDnNvEqALrvLKrK   57 (128)
                      -|||+|+|+.+|++|
T Consensus        29 ~~gd~~~A~~~lr~~   43 (198)
T PRK12332         29 ANGDMEKAIEWLREK   43 (198)
T ss_pred             cCCCHHHHHHHHHHh
Confidence            469999999999986


No 29 
>PF06506 PrpR_N:  Propionate catabolism activator;  InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain found at the N terminus of several sigma54- dependent transcriptional activators including PrpR, which activates catabolism of propionate. In Salmonella enterica subsp. enterica serovar Typhimurium, PrpR acts as a sensor of 2-methylcitrate (2-MC), an intermediate of the 2-methylcitric acid cycle used by this bacterium to convert propionate to pyruvate []. ; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay); PDB: 2Q5C_A 2PJU_A.
Probab=34.77  E-value=49  Score=24.63  Aligned_cols=25  Identities=24%  Similarity=0.441  Sum_probs=19.0

Q ss_pred             eEEEEecCCHHHHHHHHHHHHhhhh
Q 033045           38 IRVKVFNGNLEQALSWMQRKMQSSG   62 (128)
Q Consensus        38 I~V~VrDnNvEqALrvLKrKMq~eG   62 (128)
                      +.|.|.++++|.|+...++.+..+|
T Consensus        10 ~~i~v~~~~~e~~v~~a~~~~~~~g   34 (176)
T PF06506_consen   10 AEIDVIEASLEEAVEEARQLLESEG   34 (176)
T ss_dssp             SEEEEEE--HHHHHHHHHHHHTTTT
T ss_pred             ceEEEEEecHHHHHHHHHHhhHhcC
Confidence            7799999999999999999844343


No 30 
>PRK09377 tsf elongation factor Ts; Provisional
Probab=34.42  E-value=30  Score=29.32  Aligned_cols=15  Identities=33%  Similarity=1.030  Sum_probs=13.3

Q ss_pred             ecCCHHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRK   57 (128)
Q Consensus        43 rDnNvEqALrvLKrK   57 (128)
                      -|||+|+|+.+|++|
T Consensus        30 ~~gD~ekAi~~Lrk~   44 (290)
T PRK09377         30 ADGDIEKAIEWLRKK   44 (290)
T ss_pred             cCCCHHHHHHHHHHh
Confidence            479999999999975


No 31 
>TIGR00116 tsf translation elongation factor Ts. This protein is found in Bacteria, mitochondria, and chloroplasts.
Probab=33.60  E-value=31  Score=29.19  Aligned_cols=15  Identities=27%  Similarity=0.532  Sum_probs=13.6

Q ss_pred             ecCCHHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRK   57 (128)
Q Consensus        43 rDnNvEqALrvLKrK   57 (128)
                      -|||+|+|+.+|++|
T Consensus        29 ~~gDiekAi~~LRkk   43 (290)
T TIGR00116        29 ANGDFEKAIKNLRES   43 (290)
T ss_pred             cCCCHHHHHHHHHHh
Confidence            479999999999986


No 32 
>cd00194 UBA Ubiquitin Associated domain. The UBA domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. Although its specific role is so far unknown, it has been suggested that UBA domains are involved in conferring protein target specificity. The domain, a compact three helix bundle, has a conserved GFP-loop and the proline is thought to be critical for binding. The UBA domain is distinct from the conserved three helical domain seen in the N-terminus of EF-TS and eukaryotic NAC proteins.
Probab=33.24  E-value=34  Score=19.32  Aligned_cols=13  Identities=38%  Similarity=0.877  Sum_probs=10.3

Q ss_pred             EecCCHHHHHHHH
Q 033045           42 VFNGNLEQALSWM   54 (128)
Q Consensus        42 VrDnNvEqALrvL   54 (128)
                      --+||+|.|+..|
T Consensus        24 ~~~~d~~~A~~~L   36 (38)
T cd00194          24 ATNNNVERAVEWL   36 (38)
T ss_pred             HhCCCHHHHHHHH
Confidence            3469999998776


No 33 
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains. AK is the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and in fungi, is responsible for the production of threonine, isoleucine and methionine. S. cerevisiae has a single AK, which is regulated by feedback, allosteric inhibition by L-threonine. Recent studies shown that the allosteric transition triggered by binding of threonine to AK involves a large change in the conformation of the native hexameric enzyme that is converted to an inactive one of different shape and substantially smaller hydrodynamic size. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=32.54  E-value=46  Score=20.07  Aligned_cols=23  Identities=13%  Similarity=0.171  Sum_probs=19.3

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      .-+.+.|.++|.++|++.|.+-+
T Consensus        42 ~~isf~v~~~~~~~a~~~lh~~~   64 (66)
T cd04919          42 INISCVIDEKDAVKALNIIHTNL   64 (66)
T ss_pred             ceEEEEEeHHHHHHHHHHHHHHH
Confidence            45778999999999999988754


No 34 
>PF07338 DUF1471:  Protein of unknown function (DUF1471);  InterPro: IPR010854 This entry consists of several hypothetical Enterobacterial proteins of around 90 residues in length. Some of the proteins are annotated as ydgH precursors and contain two copies of this region, one at the N terminus and the other at the C terminus. The function of this family is unknown.; PDB: 2NOC_A 2JNA_B 4EVU_B.
Probab=32.35  E-value=91  Score=20.14  Aligned_cols=32  Identities=25%  Similarity=0.244  Sum_probs=27.2

Q ss_pred             chhcccceEEEEecCCHHHHHHHHHHHHhhhh
Q 033045           31 QVQQWRGIRVKVFNGNLEQALSWMQRKMQSSG   62 (128)
Q Consensus        31 qvQq~rgI~V~VrDnNvEqALrvLKrKMq~eG   62 (128)
                      |+|.--.|.|....++++.+-..|.+|=..+|
T Consensus         1 ~l~~iG~Isvs~~~~s~~d~~~~la~kAd~~G   32 (56)
T PF07338_consen    1 QLQKIGTISVSGNFGSPDDAEEALAKKADEKG   32 (56)
T ss_dssp             TCEEEEEEEEEEECSSHHHHHHHHHHHHHHTT
T ss_pred             CCeEEEEEEEccccCCHHHHHHHHHHHHHHcC
Confidence            35667778899998999999999999987776


No 35 
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules. This sub-family of MIT domains is found in proteins with an n-terminal serine/threonine kinase domain. The molecular function of the MIT domain is unclear.
Probab=32.30  E-value=1.6e+02  Score=19.83  Aligned_cols=47  Identities=23%  Similarity=0.363  Sum_probs=30.5

Q ss_pred             CCHHHHHHHHHHHHhhhhHHHHHHHHHhhccCCcHHH-HHHHHHHHHHHhhHHHH
Q 033045           45 GNLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKR-VLARKNLERKIRSQDLA   98 (128)
Q Consensus        45 nNvEqALrvLKrKMq~eGifRemK~r~~~yeKPSEKR-~raRk~~err~Rs~ela   98 (128)
                      ||.+.|+....     +||...|..-  .|||+.++| ....+-.+-.-|+++|-
T Consensus        20 g~y~eA~~lY~-----~ale~~~~~~--k~e~~~~~k~~lr~k~~eyl~RAE~LK   67 (75)
T cd02684          20 GDAAAALSLYC-----SALQYFVPAL--HYETDAQRKEALRQKVLQYVSRAEELK   67 (75)
T ss_pred             ccHHHHHHHHH-----HHHHHHHHHH--hhCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            78888887664     6888778766  379887776 33444455555544443


No 36 
>cd04920 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC). This CD includes the second of two ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein. Aspartokinase (AK) is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The lysA gene encodes the enzyme DAPDC, a pyridoxal-5'-phosphate (PLP)-dependent enzyme which catalyzes the final step in the lysine biosynthetic pathway converting meso-diaminopimelic acid (DAP) to l-lysine. Tandem ACT domains are positioned centrally with the AK catalytic domain N-terminal and the DAPDC domains C-terminal. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=31.57  E-value=48  Score=20.90  Aligned_cols=22  Identities=5%  Similarity=0.069  Sum_probs=18.5

Q ss_pred             ceEEEEecCCHHHHHHHHHHHH
Q 033045           37 GIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        37 gI~V~VrDnNvEqALrvLKrKM   58 (128)
                      -|.+.|.+.|.++|++.|-+.+
T Consensus        40 ~is~vv~~~d~~~av~~LH~~f   61 (63)
T cd04920          40 NLTFVVDEDQADGLCARLHFQL   61 (63)
T ss_pred             eEEEEEeHHHHHHHHHHHHHHH
Confidence            5668899999999999987653


No 37 
>PF01312 Bac_export_2:  FlhB HrpN YscU SpaS Family;  InterPro: IPR006135 Salmonella, and related proteobacteria, secrete large amounts of proteins into the culture media. The major secreted proteins are either flagellar proteins or virulence factors [], secreted through the flagellar or virulence export structures respectively. Both secretion systems penetrate the inner and outer membranes and their components bear substantial sequence similarity. Both the flagellar and needle like pilus look fairly similar to each other [].  The type III secretion system is of great interest, as it is used to transport virulence factors from the pathogen directly into the host cell [] and is only triggered when the bacterium comes into close contact with the host.  It is believed that the family of type III flagellar and pilus inner membrane proteins are used as structural moieties in a complex with several other subunits []. One such set of inner membrane proteins, labeled "S" here for nomenclature purposes, includes the Salmonella and Shigella SpaS, the Yersinia YscU, Rhizobium Y4YO, and the Erwinia HrcU genes, Salmonella FlhB and Escherichia coli EscU [, , , ]. Many of the proteins, in this entry, undergo autocatalytic cleavage promoted by cyclization of a conserved asparagine. These proteins belong to the MEROPS peptidase family N6. ; GO: 0009306 protein secretion, 0016020 membrane; PDB: 3C03_C 3BZT_A 3BZV_B 3BZP_A 3BZX_B 3BZL_B 3C00_A 3BZR_A 3BZY_A 3BZO_A ....
Probab=31.49  E-value=16  Score=31.04  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=0.0

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      |+||+||.++.++.=..-+|+|+..
T Consensus         7 E~pT~kkl~~ARekGqV~kS~el~~   31 (343)
T PF01312_consen    7 EKPTPKKLRDAREKGQVPKSKELTS   31 (343)
T ss_dssp             -------------------------
T ss_pred             CCCChhHHHHHHhcCCCCchHHHHH
Confidence            9999999877777778899999874


No 38 
>PRK06298 type III secretion system protein; Validated
Probab=30.76  E-value=21  Score=30.82  Aligned_cols=25  Identities=24%  Similarity=0.292  Sum_probs=20.7

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      |+||+||.+...+.=+.-+|+|+..
T Consensus         6 E~pT~kkl~~ARekGqV~kS~el~~   30 (356)
T PRK06298          6 EKATPKRLRDARKKGQVAKSQDFPS   30 (356)
T ss_pred             CCCChhHHHHHHHcCCCccchhHHH
Confidence            8999999776666667889999875


No 39 
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=30.53  E-value=20  Score=30.96  Aligned_cols=25  Identities=12%  Similarity=0.021  Sum_probs=20.5

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=..-+|+|+..
T Consensus        12 E~pT~kkl~~AR~kGqV~kS~el~~   36 (358)
T PRK13109         12 EEATERKVRDAIEKGDIPVSREAPV   36 (358)
T ss_pred             CCCChhHHHHHHhcCCCCChHhHHH
Confidence            9999999776666667889999764


No 40 
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). This CD includes the second  of two ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH). The ACT domains are positioned between the N-terminal catalytic domain of AK and the C-terminal HSDH domain found in bacteria (Escherichia coli (EC) ThrA) and higher plants (Zea mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. HSDH is the first committed reaction in the branch of the pathway that leads to Thr and Met. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathwa
Probab=30.32  E-value=53  Score=19.55  Aligned_cols=23  Identities=17%  Similarity=0.283  Sum_probs=19.6

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ..+.+.|.++|.++|++.|.+.+
T Consensus        42 ~~is~~v~~~~~~~~~~~lh~~~   64 (66)
T cd04922          42 RNISAVIDEDDATKALRAVHERF   64 (66)
T ss_pred             cEEEEEEeHHHHHHHHHHHHHHH
Confidence            56778999999999999988754


No 41 
>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). Included in this CD is the second of two ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). The first or N-terminal ACT domain of these proteins cluster with the ThrA-like ACT 1 domains (ACT_AKi-HSDH-ThrA-like_1) which includes the threonine-sensitive archaeal Methanococcus jannaschii aspartokinase ACT 1 domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=29.86  E-value=52  Score=19.49  Aligned_cols=23  Identities=13%  Similarity=0.034  Sum_probs=19.7

Q ss_pred             cceEEEEecCCHHHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKrKM   58 (128)
                      ..+.+.|.+.|+++|++.|.+.+
T Consensus        42 ~~isf~i~~~~~~~~~~~Lh~~~   64 (66)
T cd04924          42 YNISFVVAEDDGWAAVKAVHDEF   64 (66)
T ss_pred             ceEEEEEeHHHHHHHHHHHHHHh
Confidence            45778999999999999998765


No 42 
>CHL00098 tsf elongation factor Ts
Probab=29.80  E-value=41  Score=27.02  Aligned_cols=15  Identities=40%  Similarity=0.660  Sum_probs=13.4

Q ss_pred             ecCCHHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRK   57 (128)
Q Consensus        43 rDnNvEqALrvLKrK   57 (128)
                      -|||+|.|+.+|++|
T Consensus        26 ~~gd~~~A~~~Lr~~   40 (200)
T CHL00098         26 ANGDFEKALESLRQK   40 (200)
T ss_pred             cCCCHHHHHHHHHHh
Confidence            469999999999986


No 43 
>PRK05702 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=29.48  E-value=22  Score=30.61  Aligned_cols=25  Identities=16%  Similarity=0.202  Sum_probs=20.4

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=+.-+|+|+..
T Consensus        11 E~pT~kKL~dARkkGqV~kS~el~~   35 (359)
T PRK05702         11 EEPTPKKLEKAREKGQVPRSRELNT   35 (359)
T ss_pred             CCCChhHHHHHHHcCCCCchHHHHH
Confidence            8999999766666667889999864


No 44 
>TIGR00328 flhB flagellar biosynthetic protein FlhB. FlhB and its functionally equivalent orthologs, from among a larger superfamily of proteins involved in type III protein export systems, are specifically involved in flagellar protein export. The seed members are restricted and the trusted cutoff is set high such that the proteins gathered by this model play roles specifically related to flagellar structures. Full-length homologs scoring below the trusted cutoff are involved in peptide export but not necessarily in the creation of flagella.
Probab=29.32  E-value=22  Score=30.58  Aligned_cols=25  Identities=8%  Similarity=0.129  Sum_probs=20.2

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=+.-+|+|+..
T Consensus         4 E~pT~kKl~dARkkGqV~kS~el~~   28 (347)
T TIGR00328         4 EEPTPKKLRKAREEGNVPKSREVNS   28 (347)
T ss_pred             CCCChhHHHHHHhcCCCCchHhHHH
Confidence            8999999766666667889999864


No 45 
>PRK09108 type III secretion system protein HrcU; Validated
Probab=29.03  E-value=22  Score=30.57  Aligned_cols=25  Identities=20%  Similarity=0.234  Sum_probs=20.2

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=+.-+|+|+..
T Consensus         7 E~pT~KKL~dARekGqV~kS~el~~   31 (353)
T PRK09108          7 EEPTEKKLKDARKDGEVAKSPDLTA   31 (353)
T ss_pred             CCCChhHHHHHHhcCCCCchHHHHH
Confidence            8999999776666667889999753


No 46 
>PRK08156 type III secretion system protein SpaS; Validated
Probab=28.80  E-value=24  Score=30.69  Aligned_cols=25  Identities=20%  Similarity=0.288  Sum_probs=20.4

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=..-+|+|+..
T Consensus         6 E~pT~kkL~dARekGqV~kS~el~~   30 (361)
T PRK08156          6 EKPTKKKLRDSAKKGQSFKSKDLIT   30 (361)
T ss_pred             CCCChhHHHHHHHcCCCCchHhHHH
Confidence            9999999766666667889999765


No 47 
>cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1). This CD includes the second of two ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1), which can be synergistically inhibited by S-adenosylmethionine (SAM). This isoenzyme is found in higher plants, Arabidopsis thaliana (AT) and Zea mays, and also in Chlorophyta. In its inactive state, Arabidopsis AK1 binds the effectors lysine and SAM (two molecules each) at the interface of two ACT1 domain subunits. The second ACT domain (ACT2), this CD, does not interact with an effector. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=28.62  E-value=57  Score=20.46  Aligned_cols=22  Identities=14%  Similarity=0.250  Sum_probs=18.6

Q ss_pred             ceEEEEecCCHHHHHHHHHHHH
Q 033045           37 GIRVKVFNGNLEQALSWMQRKM   58 (128)
Q Consensus        37 gI~V~VrDnNvEqALrvLKrKM   58 (128)
                      -|.+.|.+.|.++|++.|.+.+
T Consensus        42 sis~~v~~~~~~~av~~Lh~~f   63 (65)
T cd04918          42 NISLIVNDSEAEGCVQALHKSF   63 (65)
T ss_pred             eEEEEEeHHHHHHHHHHHHHHH
Confidence            4668899999999999997754


No 48 
>PRK12721 secretion system apparatus protein SsaU; Reviewed
Probab=27.98  E-value=25  Score=30.17  Aligned_cols=25  Identities=16%  Similarity=0.296  Sum_probs=20.3

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=..-+|+|+..
T Consensus         6 E~pT~kkl~dARkkGqV~kS~el~~   30 (349)
T PRK12721          6 EKPTEKKLRDARKKGQVVKSVEITS   30 (349)
T ss_pred             CCCChHHHHHHHHcCCCcchhhHHH
Confidence            8999999777666667889999764


No 49 
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=27.91  E-value=25  Score=30.77  Aligned_cols=25  Identities=12%  Similarity=0.174  Sum_probs=20.3

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      ||||+||.+...+.=..-+|+|+..
T Consensus        11 E~pT~kkl~dARkkGqV~kS~el~~   35 (386)
T PRK12468         11 EEPTASKLEKAREKGQIPRSRELTS   35 (386)
T ss_pred             CCCChHHHHHHHhcCCCCchHHHHH
Confidence            8999999766666667889999875


No 50 
>smart00165 UBA Ubiquitin associated domain. Present in Rad23, SNF1-like kinases. The newly-found UBA in p62 is known to bind ubiquitin.
Probab=26.70  E-value=51  Score=18.57  Aligned_cols=12  Identities=42%  Similarity=0.753  Sum_probs=9.4

Q ss_pred             ecCCHHHHHHHH
Q 033045           43 FNGNLEQALSWM   54 (128)
Q Consensus        43 rDnNvEqALrvL   54 (128)
                      -+||+|+|+..|
T Consensus        25 ~~~d~~~A~~~L   36 (37)
T smart00165       25 ANGNVERAAEYL   36 (37)
T ss_pred             hCCCHHHHHHHH
Confidence            368999998765


No 51 
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=25.72  E-value=30  Score=30.53  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=20.9

Q ss_pred             cCCcHHHHHHHHHHHHHHhhHHHHH
Q 033045           75 IKNSEKRVLARKNLERKIRSQDLAR   99 (128)
Q Consensus        75 eKPSEKR~raRk~~err~Rs~elar   99 (128)
                      |||++||.+...+.=+.-+|+|+..
T Consensus        11 E~pT~kKl~dArekG~v~kS~el~~   35 (363)
T COG1377          11 EKPTPKKLRDAREKGQVPKSRELTS   35 (363)
T ss_pred             CCCChhhHHHHHHcCCCccchhHHH
Confidence            9999999777766667889999874


No 52 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.56  E-value=38  Score=24.07  Aligned_cols=22  Identities=23%  Similarity=0.277  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHHhhccCCcHHHHHH
Q 033045           61 SGIERLIKREQRHHIKNSEKRVLA   84 (128)
Q Consensus        61 eGifRemK~r~~~yeKPSEKR~ra   84 (128)
                      |-..|.|=.-  -=.||||+++..
T Consensus        41 e~~iR~M~~q--mGqKpSe~kI~Q   62 (71)
T COG3763          41 EEMIRMMMAQ--MGQKPSEKKINQ   62 (71)
T ss_pred             HHHHHHHHHH--hCCCchHHHHHH
Confidence            4555665443  247999999743


No 53 
>PRK01844 hypothetical protein; Provisional
Probab=23.69  E-value=44  Score=23.68  Aligned_cols=24  Identities=13%  Similarity=0.138  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHhhccCCcHHHHHHHH
Q 033045           61 SGIERLIKREQRHHIKNSEKRVLARK   86 (128)
Q Consensus        61 eGifRemK~r~~~yeKPSEKR~raRk   86 (128)
                      |-..|.|=.-  -=.||||+++.+=-
T Consensus        41 e~mir~Mm~Q--MGqkPSekki~Q~m   64 (72)
T PRK01844         41 EQMLKMMMMQ--MGQKPSQKKINQMM   64 (72)
T ss_pred             HHHHHHHHHH--hCCCccHHHHHHHH
Confidence            4455555322  24799999975543


No 54 
>PRK00523 hypothetical protein; Provisional
Probab=23.62  E-value=45  Score=23.66  Aligned_cols=23  Identities=17%  Similarity=0.114  Sum_probs=15.0

Q ss_pred             hhHHHHHHHHHhhccCCcHHHHHHH
Q 033045           61 SGIERLIKREQRHHIKNSEKRVLAR   85 (128)
Q Consensus        61 eGifRemK~r~~~yeKPSEKR~raR   85 (128)
                      |-..|.|=.-  -=.||||+++.+=
T Consensus        42 e~mir~M~~Q--MGqKPSekki~Q~   64 (72)
T PRK00523         42 ENMIRAMYMQ--MGRKPSESQIKQV   64 (72)
T ss_pred             HHHHHHHHHH--hCCCccHHHHHHH
Confidence            5666666333  2479999997543


No 55 
>COG3603 Uncharacterized conserved protein [Function unknown]
Probab=23.41  E-value=65  Score=25.19  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=15.1

Q ss_pred             EEEEecCCHHHHHHHHH
Q 033045           39 RVKVFNGNLEQALSWMQ   55 (128)
Q Consensus        39 ~V~VrDnNvEqALrvLK   55 (128)
                      .|.|+.+|+|+|.+.|+
T Consensus       104 hiLVr~~dLekAv~~L~  120 (128)
T COG3603         104 HILVREEDLEKAVKALE  120 (128)
T ss_pred             eEEEehhhHHHHHHHHH
Confidence            38899999999999886


No 56 
>PF00486 Trans_reg_C:  Transcriptional regulatory protein, C terminal;  InterPro: IPR001867 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain that is almost always found associated with the response regulator receiver domain (see IPR001789 from INTERPRO). It may play a role in DNA binding [].; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2K4J_A 2JPB_A 1ODD_A 1OPC_A 1KGS_A 2PMU_E 2JZY_A 1GXP_B 1QQI_A 2Z33_A ....
Probab=23.14  E-value=43  Score=20.74  Aligned_cols=22  Identities=23%  Similarity=0.536  Sum_probs=19.3

Q ss_pred             EEecCCHHHHHHHHHHHHhhhh
Q 033045           41 KVFNGNLEQALSWMQRKMQSSG   62 (128)
Q Consensus        41 ~VrDnNvEqALrvLKrKMq~eG   62 (128)
                      .+-+++++..+.-|++|+...|
T Consensus        40 ~~~~~~l~~~I~rLR~kL~~~~   61 (77)
T PF00486_consen   40 DVSDNSLDVHISRLRKKLEDAG   61 (77)
T ss_dssp             TTCTHHHHHHHHHHHHHHHSST
T ss_pred             ccchhhHHHHHHHHHHHHhhcC
Confidence            5678999999999999999864


No 57 
>PF07721 TPR_4:  Tetratricopeptide repeat;  InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models. The tetratricopeptide repeat (TPR) motif is a protein-protein interaction module found in multiple copies in a number of functionally different proteins that facilitates specific interactions with a partner protein(s) [].; GO: 0042802 identical protein binding
Probab=22.81  E-value=57  Score=17.40  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=11.1

Q ss_pred             EecCCHHHHHHHHH
Q 033045           42 VFNGNLEQALSWMQ   55 (128)
Q Consensus        42 VrDnNvEqALrvLK   55 (128)
                      ...|+.|+|.+++.
T Consensus        12 ~~~G~~~eA~~~l~   25 (26)
T PF07721_consen   12 LAQGDPDEAERLLR   25 (26)
T ss_pred             HHcCCHHHHHHHHh
Confidence            34599999999875


No 58 
>smart00668 CTLH C-terminal to LisH motif. Alpha-helical motif of unknown function.
Probab=22.68  E-value=55  Score=19.40  Aligned_cols=16  Identities=25%  Similarity=0.831  Sum_probs=13.3

Q ss_pred             EEecCCHHHHHHHHHH
Q 033045           41 KVFNGNLEQALSWMQR   56 (128)
Q Consensus        41 ~VrDnNvEqALrvLKr   56 (128)
                      .|.+||++.|+..+..
T Consensus        11 ~i~~g~~~~a~~~~~~   26 (58)
T smart00668       11 LILKGDWDEALEWLSS   26 (58)
T ss_pred             HHHcCCHHHHHHHHHH
Confidence            4678999999998854


No 59 
>PF07660 STN:  Secretin and TonB N terminus short domain;  InterPro: IPR011662 This is a conserved region found at the N-terminal region of bacterial proteins involved in either protein secretion or the uptake of selective substrates, including:   Bundle-forming pilus protein B, an outer-membrane protein absolutely required for pilus biogenesis, and for enteropathogenic Escherichia coli localized adherence and autoaggregation []. PilQ, which is required for type IV pilus biogenesis and competence and is thought to function both as a pore for exit of the pilus and as a channel for entry of haem and antimicrobial agents and uptake of transforming DNA []. PupB, a specific receptor for the siderophores ferric pseudobactin BN8 and ferric pseudobactin BN7, iron chelating molecules that allow the organism to extract iron from the environment, especially under iron-restricted conditions []. TonB, which couples the electrochemical potential of the cytoplasmic membrane to the active transport of iron-siderophores and vitamin B12 across the outer membrane [].  ; GO: 0019867 outer membrane; PDB: 2D1U_A 1ZZV_A 2W75_B 2O5P_A 2W77_A 2W16_A 2W6U_B 2W6T_A 2W76_B 2W78_B ....
Probab=22.64  E-value=76  Score=18.88  Aligned_cols=25  Identities=28%  Similarity=0.339  Sum_probs=15.7

Q ss_pred             cchhcccceEEEEecCCHHHHHHHH
Q 033045           30 HQVQQWRGIRVKVFNGNLEQALSWM   54 (128)
Q Consensus        30 ~qvQq~rgI~V~VrDnNvEqALrvL   54 (128)
                      ..+...+.+.|.+.|-.+|+||..|
T Consensus         8 ~~v~~~~~vsl~~~~~~~~~~L~~l   32 (52)
T PF07660_consen    8 DDVNGKKKVSLDVKNMSLEEALDQL   32 (52)
T ss_dssp             CCCTT-BE--EE-EEE-HHHHHHHH
T ss_pred             HHhCCCcceeEEcCCcCHHHHHHHH
Confidence            3466677888888999999999865


No 60 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=22.50  E-value=1.1e+02  Score=19.68  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=13.2

Q ss_pred             HhhcccchhhHHHHHhHhc
Q 033045          108 KVRRDRSFGFAMVAFFFLL  126 (128)
Q Consensus       108 kiRg~~~~~~~~~~~~~~~  126 (128)
                      ==||=--||.+|+..|..+
T Consensus        12 YEr~Wi~F~l~mi~vFi~l   30 (38)
T PF09125_consen   12 YERGWIAFALAMILVFIAL   30 (38)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhHHHHHHHHHHHHHHH
Confidence            3344446999999888654


No 61 
>PF03197 FRD2:  Bacteriophage FRD2 protein;  InterPro: IPR004885 This is group of bacteriophage proteins has no known function. 
Probab=22.34  E-value=1.1e+02  Score=23.15  Aligned_cols=21  Identities=19%  Similarity=0.341  Sum_probs=18.8

Q ss_pred             ceEEEEecCCHHHHHHHHHHH
Q 033045           37 GIRVKVFNGNLEQALSWMQRK   57 (128)
Q Consensus        37 gI~V~VrDnNvEqALrvLKrK   57 (128)
                      .|.+.|-.||+++-+..||+-
T Consensus        79 ~IHciVde~NvdeIIeLl~kT   99 (102)
T PF03197_consen   79 KIHCIVDENNVDEIIELLQKT   99 (102)
T ss_pred             EEEEEEccCCHHHHHHHHHHH
Confidence            488999999999999999874


No 62 
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters, such as leucine-isoleucine-valine-binding protein (LIVBP); however their ligand specificity has not been determined experimentally.
Probab=22.31  E-value=93  Score=24.77  Aligned_cols=28  Identities=14%  Similarity=0.087  Sum_probs=24.4

Q ss_pred             cceEEEEecC--CHHHHHHHHHHHHhhhhH
Q 033045           36 RGIRVKVFNG--NLEQALSWMQRKMQSSGI   63 (128)
Q Consensus        36 rgI~V~VrDn--NvEqALrvLKrKMq~eGi   63 (128)
                      ++|++.+.|+  |.++|+...++=+.++|+
T Consensus        41 ~~i~lv~~D~~~~p~~a~~~a~~li~~d~v   70 (357)
T cd06337          41 YEVEIIVRDSQSNPNRAGLVAQELILTDKV   70 (357)
T ss_pred             eEEEEEEecCCCCHHHHHHHHHHHHhccCc
Confidence            4688999998  999999999998888765


No 63 
>PF13176 TPR_7:  Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A.
Probab=22.15  E-value=1.1e+02  Score=17.06  Aligned_cols=14  Identities=21%  Similarity=0.584  Sum_probs=11.2

Q ss_pred             ecCCHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQR   56 (128)
Q Consensus        43 rDnNvEqALrvLKr   56 (128)
                      .-||.|+|+...++
T Consensus        11 ~~g~~~~Ai~~y~~   24 (36)
T PF13176_consen   11 QQGDYEKAIEYYEQ   24 (36)
T ss_dssp             HCT-HHHHHHHHHH
T ss_pred             HcCCHHHHHHHHHH
Confidence            35899999999988


No 64 
>PF13428 TPR_14:  Tetratricopeptide repeat
Probab=21.98  E-value=1e+02  Score=17.73  Aligned_cols=19  Identities=16%  Similarity=0.204  Sum_probs=15.2

Q ss_pred             ecCCHHHHHHHHHHHHhhh
Q 033045           43 FNGNLEQALSWMQRKMQSS   61 (128)
Q Consensus        43 rDnNvEqALrvLKrKMq~e   61 (128)
                      .-|+.|+|++++++=++..
T Consensus        13 ~~G~~~~A~~~~~~~l~~~   31 (44)
T PF13428_consen   13 RLGQPDEAERLLRRALALD   31 (44)
T ss_pred             HcCCHHHHHHHHHHHHHHC
Confidence            4599999999998876653


No 65 
>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis]
Probab=21.97  E-value=66  Score=27.91  Aligned_cols=15  Identities=40%  Similarity=1.015  Sum_probs=13.4

Q ss_pred             ecCCHHHHHHHHHHH
Q 033045           43 FNGNLEQALSWMQRK   57 (128)
Q Consensus        43 rDnNvEqALrvLKrK   57 (128)
                      -+||+|+|+.+|++|
T Consensus        30 ~~Gd~EkAie~LR~k   44 (296)
T COG0264          30 ANGDIEKAIEWLREK   44 (296)
T ss_pred             cCCCHHHHHHHHHHh
Confidence            489999999999885


No 66 
>PRK10564 maltose regulon periplasmic protein; Provisional
Probab=21.34  E-value=47  Score=28.77  Aligned_cols=21  Identities=24%  Similarity=0.515  Sum_probs=17.2

Q ss_pred             cceEEEEecCCHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQR   56 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKr   56 (128)
                      ..|+=-|.+||+|+||+.|..
T Consensus       262 ~aI~~AVk~gDi~KAL~LldE  282 (303)
T PRK10564        262 QAIKQAVKKGDVDKALKLLDE  282 (303)
T ss_pred             HHHHHHHHcCCHHHHHHHHHH
Confidence            456667999999999999853


No 67 
>COG4080 SpoU rRNA Methylase family enzyme [General function prediction only]
Probab=21.13  E-value=50  Score=26.31  Aligned_cols=26  Identities=31%  Similarity=0.374  Sum_probs=20.7

Q ss_pred             cchhc---ccceEEEEecCCHHHHHHHHHH
Q 033045           30 HQVQQ---WRGIRVKVFNGNLEQALSWMQR   56 (128)
Q Consensus        30 ~qvQq---~rgI~V~VrDnNvEqALrvLKr   56 (128)
                      ++++.   ..|..|.|. +++|.|+.+|+-
T Consensus        46 p~~~kla~k~G~~vlvf-~dL~DAlevL~P   74 (147)
T COG4080          46 PEVLKLAFKLGKPVLVF-PDLDDALEVLRP   74 (147)
T ss_pred             HHHHHHHHHhCCcEEEe-hhHHHHHHhcCC
Confidence            44554   678999999 899999999863


No 68 
>PF13181 TPR_8:  Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A ....
Probab=20.49  E-value=1e+02  Score=16.09  Aligned_cols=16  Identities=25%  Similarity=0.665  Sum_probs=12.7

Q ss_pred             cCCHHHHHHHHHHHHh
Q 033045           44 NGNLEQALSWMQRKMQ   59 (128)
Q Consensus        44 DnNvEqALrvLKrKMq   59 (128)
                      -||.|+|+..+++=++
T Consensus        14 ~~~~~~A~~~~~~a~~   29 (34)
T PF13181_consen   14 LGDYEEALEYFEKALE   29 (34)
T ss_dssp             TTSHHHHHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHh
Confidence            3899999999887544


No 69 
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed
Probab=20.41  E-value=1.2e+02  Score=22.12  Aligned_cols=50  Identities=18%  Similarity=0.138  Sum_probs=29.8

Q ss_pred             HHHhhhccccCCCCcccccccccccccchhcccceEEEEe-cCCHHHHHHHHHH
Q 033045            4 VGRQLAGYLTQPSQGLNLFSRNQCQRHQVQQWRGIRVKVF-NGNLEQALSWMQR   56 (128)
Q Consensus         4 iar~~~~l~~~~~~~~~~~~~~~~~~~qvQq~rgI~V~Vr-DnNvEqALrvLKr   56 (128)
                      +--+++|+|...+.|+...+...-+   .....-|.+.|. |..+||-.+-|.|
T Consensus        21 VL~RIaglFsRRgyNIeSLtvg~te---~~~iSRmtivv~~~~~i~Qi~kQL~K   71 (96)
T PRK08178         21 VMSHVCGLFARRAFNVEGILCLPIQ---DGDKSRIWLLVNDDQRLEQMISQIEK   71 (96)
T ss_pred             HHHHHHHHHhcCCcCeeeEEEeecC---CCCceEEEEEEcCchHHHHHHHHHhC
Confidence            4567899999999887655443333   334344555554 4445565555554


No 70 
>PF02845 CUE:  CUE domain;  InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs). CUE domains also occur in two proteins of the IL-1 signal transduction pathway, tollip and TAB2.; GO: 0005515 protein binding; PDB: 2EKF_A 1OTR_A 1P3Q_Q 1MN3_A 1WGL_A 2EJS_A 2DAE_A 2DHY_A 2DI0_A.
Probab=20.20  E-value=84  Score=18.59  Aligned_cols=12  Identities=33%  Similarity=0.545  Sum_probs=9.7

Q ss_pred             ecCCHHHHHHHH
Q 033045           43 FNGNLEQALSWM   54 (128)
Q Consensus        43 rDnNvEqALrvL   54 (128)
                      .|||+|.|+..|
T Consensus        27 ~~~~ve~ai~~L   38 (42)
T PF02845_consen   27 NNGDVEAAIDAL   38 (42)
T ss_dssp             TTTTHHHHHHHH
T ss_pred             cCCCHHHHHHHH
Confidence            479999998765


No 71 
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=20.08  E-value=1.3e+02  Score=19.63  Aligned_cols=21  Identities=14%  Similarity=0.276  Sum_probs=17.9

Q ss_pred             cceEEEEecCCHHHHHHHHHH
Q 033045           36 RGIRVKVFNGNLEQALSWMQR   56 (128)
Q Consensus        36 rgI~V~VrDnNvEqALrvLKr   56 (128)
                      =|+-+.+.++|.|.+..+|++
T Consensus        41 CG~al~~~~~d~~~i~~~l~~   61 (73)
T PF11823_consen   41 CGLALRFEPEDLEKIKEILEE   61 (73)
T ss_pred             CCEEEEEChhhHHHHHHHHHH
Confidence            356689999999999999986


No 72 
>PF14626 RNase_Zc3h12a_2:  Zc3h12a-like Ribonuclease NYN domain
Probab=20.06  E-value=36  Score=26.29  Aligned_cols=9  Identities=44%  Similarity=0.349  Sum_probs=7.5

Q ss_pred             hhccCCcHH
Q 033045           72 RHHIKNSEK   80 (128)
Q Consensus        72 ~~yeKPSEK   80 (128)
                      -+|+||||+
T Consensus       100 ~~y~k~ser  108 (122)
T PF14626_consen  100 IHYNKPSER  108 (122)
T ss_pred             ccccCcccc
Confidence            479999996


Done!