BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033054
         (128 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G5U|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
          Length = 1284

 Score = 25.4 bits (54), Expect = 8.7,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 32/54 (59%)

Query: 45  SHAKLIKSGISNVASGILQTLMYAFRIGLAYLVMLAVMSFNIGVLLAAVAGYSV 98
           S   +I   I+N+ +GI+ +L+Y +++ L  L ++ +++    V +  ++G ++
Sbjct: 827 SRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQAL 880


>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G60|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G61|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G61|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
          Length = 1284

 Score = 25.4 bits (54), Expect = 8.7,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 32/54 (59%)

Query: 45  SHAKLIKSGISNVASGILQTLMYAFRIGLAYLVMLAVMSFNIGVLLAAVAGYSV 98
           S   +I   I+N+ +GI+ +L+Y +++ L  L ++ +++    V +  ++G ++
Sbjct: 827 SRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQAL 880


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.144    0.451 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,413,702
Number of Sequences: 62578
Number of extensions: 109049
Number of successful extensions: 274
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 271
Number of HSP's gapped (non-prelim): 3
length of query: 128
length of database: 14,973,337
effective HSP length: 87
effective length of query: 41
effective length of database: 9,529,051
effective search space: 390691091
effective search space used: 390691091
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)