BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033060
         (128 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
 pdb|3RHC|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
 pdb|3RHC|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
          Length = 113

 Score = 26.6 bits (57), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 2/23 (8%)

Query: 54 GPQEERLM--LSGMHTVEDIFCC 74
          GPQ ++++  L+G HTV ++F C
Sbjct: 58 GPQLQKVLERLTGQHTVPNVFVC 80


>pdb|1LSH|B Chain B, Lipid-Protein Interactions In Lipovitellin
          Length = 319

 Score = 25.4 bits (54), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 2   GRIFLVELKGRSYYK--CRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGP 55
            +I  VEL   S +K   +F  S    A + + W  NC++ RA L +   N+   P
Sbjct: 87  AKIVAVELSDLSVWKLCAKFRLSAHMKAKAAIGWGKNCQQYRAMLEASTGNLQSHP 142


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.468 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,298,594
Number of Sequences: 62578
Number of extensions: 109412
Number of successful extensions: 214
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 2
length of query: 128
length of database: 14,973,337
effective HSP length: 87
effective length of query: 41
effective length of database: 9,529,051
effective search space: 390691091
effective search space used: 390691091
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)