BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033060
(128 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5
From Arabidopsis Thaliana
pdb|3RHC|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C5
From Arabidopsis Thaliana
pdb|3RHC|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C5
From Arabidopsis Thaliana
Length = 113
Score = 26.6 bits (57), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 2/23 (8%)
Query: 54 GPQEERLM--LSGMHTVEDIFCC 74
GPQ ++++ L+G HTV ++F C
Sbjct: 58 GPQLQKVLERLTGQHTVPNVFVC 80
>pdb|1LSH|B Chain B, Lipid-Protein Interactions In Lipovitellin
Length = 319
Score = 25.4 bits (54), Expect = 7.7, Method: Compositional matrix adjust.
Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
Query: 2 GRIFLVELKGRSYYK--CRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGP 55
+I VEL S +K +F S A + + W NC++ RA L + N+ P
Sbjct: 87 AKIVAVELSDLSVWKLCAKFRLSAHMKAKAAIGWGKNCQQYRAMLEASTGNLQSHP 142
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.140 0.468
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,298,594
Number of Sequences: 62578
Number of extensions: 109412
Number of successful extensions: 214
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 2
length of query: 128
length of database: 14,973,337
effective HSP length: 87
effective length of query: 41
effective length of database: 9,529,051
effective search space: 390691091
effective search space used: 390691091
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)