Citrus Sinensis ID: 033061

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI
cccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEccccccHHHHHcHHHHHHHccccEEEEccHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHcc
cccHcccccccccccHHHHHHHHHHHHHHHHHccEEEcHHHHHHHHHHccccEEEEEcccccHHHcccHHHHHHcccccEEEEccHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHHcc
mtgeavnpkaypladsnlTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLhlpllaedknvpyvfvpskqalgracgvtrpviacsvtsneASQLKTQIQQLKDAIEKLLI
mtgeavnpkaypladsNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSvtsneasqlktQIQQLKDAIEKLLI
MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTepleillhlpllAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI
***********PLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVT***********************
*****VN**AYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI
********KAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI
*****VNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIAxxxxxxxxxxxxxxxxxxxxxIEKLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q5XH16128 NHP2-like protein 1 OS=Xe N/A no 1.0 1.0 0.804 3e-55
Q6P8E9128 NHP2-like protein 1 OS=Xe yes no 1.0 1.0 0.804 3e-55
O74690125 13 kDa ribonucleoprotein- yes no 0.968 0.992 0.822 7e-54
Q6C0I0126 13 kDa ribonucleoprotein- yes no 0.953 0.968 0.795 4e-52
Q5ANL6126 13 kDa ribonucleoprotein- N/A no 0.968 0.984 0.798 6e-52
Q6BLQ3126 13 kDa ribonucleoprotein- yes no 0.968 0.984 0.798 7e-52
Q4P0K3126 13 kDa ribonucleoprotein- N/A no 0.968 0.984 0.774 1e-51
P39990126 13 kDa ribonucleoprotein- yes no 0.968 0.984 0.782 3e-51
P55770128 NHP2-like protein 1 OS=Ra yes no 1.0 1.0 0.789 6e-51
Q9D0T1128 NHP2-like protein 1 OS=Mu yes no 1.0 1.0 0.789 6e-51
>sp|Q5XH16|NH2L1_XENLA NHP2-like protein 1 OS=Xenopus laevis GN=nhp2l1 PE=2 SV=1 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%)

Query: 1   MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADT 60
           MT   VNPKAYPLAD+ LT T+LDLVQQ+ANYKQL+KGANEATKTLNRGI+EFIVMAAD 
Sbjct: 1   MTEPEVNPKAYPLADAQLTKTLLDLVQQSANYKQLRKGANEATKTLNRGIAEFIVMAADA 60

Query: 61  EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLK 120
           EPLEI+LHLPLL EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++
Sbjct: 61  EPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKPQIQSVQ 120

Query: 121 DAIEKLLI 128
            AIE+LL+
Sbjct: 121 QAIERLLV 128
Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.
Xenopus laevis (taxid: 8355)
>sp|Q6P8E9|NH2L1_XENTR NHP2-like protein 1 OS=Xenopus tropicalis GN=nhp2l1 PE=2 SV=1 Back     alignment and function description
>sp|O74690|SNU13_SCHPO 13 kDa ribonucleoprotein-associated protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snu13 PE=3 SV=1 Back     alignment and function description
>sp|Q6C0I0|SNU13_YARLI 13 kDa ribonucleoprotein-associated protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNU13 PE=3 SV=1 Back     alignment and function description
>sp|Q5ANL6|SNU13_CANAL 13 kDa ribonucleoprotein-associated protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNU13 PE=3 SV=1 Back     alignment and function description
>sp|Q6BLQ3|SNU13_DEBHA 13 kDa ribonucleoprotein-associated protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNU13 PE=3 SV=1 Back     alignment and function description
>sp|Q4P0K3|SNU13_USTMA 13 kDa ribonucleoprotein-associated protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SNU13 PE=3 SV=1 Back     alignment and function description
>sp|P39990|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU13 PE=1 SV=1 Back     alignment and function description
>sp|P55770|NH2L1_RAT NHP2-like protein 1 OS=Rattus norvegicus GN=Nhp2l1 PE=2 SV=4 Back     alignment and function description
>sp|Q9D0T1|NH2L1_MOUSE NHP2-like protein 1 OS=Mus musculus GN=Nhp2l1 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
255566991128 ribosomal protein l7ae, putative [Ricinu 1.0 1.0 0.960 3e-58
313586557128 60S ribosomal protein L7aA [Hevea brasil 1.0 1.0 0.968 6e-58
449443099128 PREDICTED: NHP2-like protein 1-like [Cuc 1.0 1.0 0.953 7e-58
356563028128 PREDICTED: NHP2-like protein 1-like [Gly 1.0 1.0 0.945 1e-57
225449319128 PREDICTED: NHP2-like protein 1-like [Vit 1.0 1.0 0.953 1e-57
388513781128 unknown [Medicago truncatula] 1.0 1.0 0.937 3e-57
296086147142 unnamed protein product [Vitis vinifera] 0.992 0.894 0.952 4e-57
297812201128 ribosomal protein L7Ae/L30e/S12e/Gadd45 1.0 1.0 0.945 4e-57
351727467128 uncharacterized protein LOC100527424 [Gl 1.0 1.0 0.937 5e-57
297738940150 unnamed protein product [Vitis vinifera] 0.984 0.84 0.952 5e-57
>gi|255566991|ref|XP_002524478.1| ribosomal protein l7ae, putative [Ricinus communis] gi|223536266|gb|EEF37918.1| ribosomal protein l7ae, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  229 bits (584), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 126/128 (98%)

Query: 1   MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADT 60
           MTGEAVNPKAYPLAD+ LTITILDLVQQAANYKQLKKGANEATKTLNRGISEF+VMAADT
Sbjct: 1   MTGEAVNPKAYPLADAQLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADT 60

Query: 61  EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLK 120
           EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVT+NE SQLKTQIQQLK
Sbjct: 61  EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTTNEGSQLKTQIQQLK 120

Query: 121 DAIEKLLI 128
           DAIEKLLI
Sbjct: 121 DAIEKLLI 128

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|313586557|gb|ADR71289.1| 60S ribosomal protein L7aA [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|449443099|ref|XP_004139318.1| PREDICTED: NHP2-like protein 1-like [Cucumis sativus] gi|449493622|ref|XP_004159380.1| PREDICTED: NHP2-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356563028|ref|XP_003549768.1| PREDICTED: NHP2-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|225449319|ref|XP_002281586.1| PREDICTED: NHP2-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388513781|gb|AFK44952.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|296086147|emb|CBI31588.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297812201|ref|XP_002873984.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Arabidopsis lyrata subsp. lyrata] gi|297319821|gb|EFH50243.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351727467|ref|NP_001235882.1| uncharacterized protein LOC100527424 [Glycine max] gi|255632312|gb|ACU16514.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297738940|emb|CBI28185.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2127455128 AT4G22380 [Arabidopsis thalian 1.0 1.0 0.835 1.7e-50
TAIR|locus:2149269160 AT5G20160 [Arabidopsis thalian 0.679 0.543 0.816 2.6e-49
UNIPROTKB|F1NII6144 NHP2L1 "Uncharacterized protei 1.0 0.888 0.695 2.2e-41
UNIPROTKB|Q3B8S0128 NHP2L1 "NHP2-like protein 1" [ 1.0 1.0 0.703 2.2e-41
UNIPROTKB|P55769128 NHP2L1 "NHP2-like protein 1" [ 1.0 1.0 0.703 2.2e-41
UNIPROTKB|F2Z5V3128 NHP2L1 "Uncharacterized protei 1.0 1.0 0.703 2.2e-41
RGD|1303103128 Nhp2l1 "NHP2 non-histone chrom 1.0 1.0 0.703 2.2e-41
WB|WBGene00010896128 M28.5 [Caenorhabditis elegans 1.0 1.0 0.695 2.2e-41
POMBASE|SPAC607.03c125 snu13 "U3 snoRNP-associated pr 0.968 0.992 0.733 4.6e-41
ZFIN|ZDB-GENE-030131-9670128 nhp2l1b "NHP2 non-histone chro 1.0 1.0 0.718 4.6e-41
TAIR|locus:2127455 AT4G22380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 525 (189.9 bits), Expect = 1.7e-50, P = 1.7e-50
 Identities = 107/128 (83%), Positives = 111/128 (86%)

Query:     1 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADT 60
             MTGE VNPKAYPLADS L+ITI+DLVQQA NYKQLKKGANEATKTLNRGISEF+VMAAD 
Sbjct:     1 MTGEVVNPKAYPLADSQLSITIMDLVQQATNYKQLKKGANEATKTLNRGISEFVVMAADA 60

Query:    61 XXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLK 120
                         AEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLK+QIQ LK
Sbjct:    61 EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLK 120

Query:   121 DAIEKLLI 128
             DAIEKLLI
Sbjct:   121 DAIEKLLI 128
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0005730 "nucleolus" evidence=IEA;IDA
GO:0030529 "ribonucleoprotein complex" evidence=IEA
GO:0042254 "ribosome biogenesis" evidence=IEA
TAIR|locus:2149269 AT5G20160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NII6 NHP2L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B8S0 NHP2L1 "NHP2-like protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P55769 NHP2L1 "NHP2-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5V3 NHP2L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1303103 Nhp2l1 "NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00010896 M28.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC607.03c snu13 "U3 snoRNP-associated protein Snu13" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9670 nhp2l1b "NHP2 non-histone chromosome protein 2-like 1b (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P8E9NH2L1_XENTRNo assigned EC number0.80461.01.0yesno
P55770NH2L1_RATNo assigned EC number0.78901.01.0yesno
P0CQ52SNU13_CRYNJNo assigned EC number0.77040.95310.9606yesno
Q6BLQ3SNU13_DEBHANo assigned EC number0.79830.96870.9841yesno
P0CQ53SNU13_CRYNBNo assigned EC number0.77040.95310.9606N/Ano
Q54ST0NH2L1_DICDINo assigned EC number0.63281.00.9922yesno
Q6CM69SNU13_KLULANo assigned EC number0.75800.96870.9841yesno
Q5XH16NH2L1_XENLANo assigned EC number0.80461.01.0N/Ano
P39990SNU13_YEASTNo assigned EC number0.78220.96870.9841yesno
P12743RL7A_HALMANo assigned EC number0.34230.85150.9083yesno
P55769NH2L1_HUMANNo assigned EC number0.78901.01.0yesno
Q5ANL6SNU13_CANALNo assigned EC number0.79830.96870.9841N/Ano
Q3B8S0NH2L1_BOVINNo assigned EC number0.78901.01.0yesno
Q4P0K3SNU13_USTMANo assigned EC number0.77410.96870.9841N/Ano
Q4R5C6NH2L1_MACFANo assigned EC number0.78901.01.0N/Ano
Q9YAX7RL7A_AERPENo assigned EC number0.37830.85150.8582yesno
O29494RL7A_ARCFUNo assigned EC number0.37270.82030.8823yesno
Q21568NH2L1_CAEELNo assigned EC number0.78901.01.0yesno
O74690SNU13_SCHPONo assigned EC number0.82250.96870.992yesno
Q971C9RL7A_SULTONo assigned EC number0.41810.84370.8571yesno
Q6FQV5SNU13_CANGANo assigned EC number0.76610.96870.9841yesno
Q757T2SNU13_ASHGONo assigned EC number0.77040.95310.9606yesno
Q9U3Z7NH2L1_DROMENo assigned EC number0.7040.97650.9842yesno
Q6C0I0SNU13_YARLINo assigned EC number0.79500.95310.9682yesno
Q9D0T1NH2L1_MOUSENo assigned EC number0.78901.01.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.6__2052__AT5G20160.2
annotation not avaliable (128 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.4__2676__AT2G44860.1
annotation not avaliable (161 aa)
•  •• • 0.912
fgenesh2_kg.5__2151__AT3G57150.1
annotation not avaliable (561 aa)
   •• • 0.801
Al_scaffold_0004_1220
annotation not avaliable (460 aa)
• •   • 0.723
scaffold_703188.1
annotation not avaliable (105 aa)
  ••  • 0.700
fgenesh2_kg.3__2555__AT3G23390.1
annotation not avaliable (105 aa)
  ••  • 0.700
fgenesh1_pm.C_scaffold_7002163
annotation not avaliable (187 aa)
   •  • 0.686
fgenesh2_kg.3__3577__AT2G20490.1
annotation not avaliable (64 aa)
   •• • 0.667
scaffold_601582.1
annotation not avaliable (143 aa)
  ••  • 0.647
fgenesh2_kg.3__137__AT3G02080.1
annotation not avaliable (142 aa)
  ••  • 0.646
fgenesh2_kg.8__1775__AT5G58420.1
annotation not avaliable (262 aa)
  ••  • 0.637

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 1e-29
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 1e-29
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 1e-26
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 6e-26
PTZ00365266 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-lik 2e-06
PTZ00222263 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Pro 2e-05
PRK1360282 PRK13602, PRK13602, putative ribosomal protein L7A 2e-04
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  103 bits (258), Expect = 1e-29
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 3/115 (2%)

Query: 9   KAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLH 68
            A PLA   L    L L+ +A+   +LKKG NE TK + RG ++ +V+A D  P E++ H
Sbjct: 2   YAKPLAPEMLEQKALSLLGKASRAGKLKKGTNEVTKAIERGKAKLVVIAEDVSPEELVKH 61

Query: 69  LPLLAEDKNVPYVFVPSKQALGRACGV-TRPVIACSVT--SNEASQLKTQIQQLK 120
           LP L E+KNVPYV+V SK+ LG+A G   R V+A      + +   L  ++++LK
Sbjct: 62  LPALCEEKNVPYVYVGSKKELGKAVGKEVRKVVAIVDKGFAKKLEDLVEKVEELK 116

Length = 116
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information
>gnl|CDD|240382 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>gnl|CDD|140249 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>gnl|CDD|184174 PRK13602, PRK13602, putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.97
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.97
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.96
KOG3167153 consensus Box H/ACA snoRNP component, involved in 99.96
PTZ00106108 60S ribosomal protein L30; Provisional 99.95
PRK07714100 hypothetical protein; Provisional 99.94
PRK0728398 hypothetical protein; Provisional 99.94
PRK0101899 50S ribosomal protein L30e; Reviewed 99.94
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.94
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.92
PRK0668382 hypothetical protein; Provisional 99.92
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.92
KOG3387131 consensus 60S ribosomal protein 15.5kD/SNU13, NHP2 99.9
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.9
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.88
PRK09190220 hypothetical protein; Provisional 99.87
PTZ00222263 60S ribosomal protein L7a; Provisional 99.86
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.83
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.78
KOG3406134 consensus 40S ribosomal protein S12 [Translation, 99.68
KOG2988112 consensus 60S ribosomal protein L30 [Translation, 99.21
KOG3166209 consensus 60S ribosomal protein L7A [Translation, 98.14
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 98.09
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 96.63
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 96.56
PRK04011411 peptide chain release factor 1; Provisional 95.71
PF15608100 PELOTA_1: PELOTA RNA binding domain 95.64
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 95.59
TIGR00111351 pelota probable translation factor pelota. This mo 95.32
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 95.1
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.07
PRK11181 244 23S rRNA (guanosine-2'-O-)-methyltransferase; Prov 92.73
PRK10864 346 putative methyltransferase; Provisional 92.37
cd01422115 MGS Methylglyoxal synthase catalyzes the enolizati 91.85
TIGR00186 237 rRNA_methyl_3 rRNA methylase, putative, group 3. t 91.36
PF0214295 MGS: MGS-like domain This is a subfamily of this f 89.34
PRK05234142 mgsA methylglyoxal synthase; Validated 88.28
PF07997120 DUF1694: Protein of unknown function (DUF1694); In 88.18
cd00532112 MGS-like MGS-like domain. This domain composes the 88.18
COG1537352 PelA Predicted RNA-binding proteins [General funct 87.46
PLN02821460 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate red 86.82
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 85.42
smart0085190 MGS MGS-like domain. This domain composes the whol 85.24
PF02603127 Hpr_kinase_N: HPr Serine kinase N terminus; InterP 85.02
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 83.51
PRK01045298 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate redu 82.17
TIGR00216280 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyroph 82.01
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 81.53
COG0566 260 SpoU rRNA methylases [Translation, ribosomal struc 81.11
PF03618 255 Kinase-PPPase: Kinase/pyrophosphorylase; InterPro: 81.0
PRK12360281 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 80.36
PF1182373 DUF3343: Protein of unknown function (DUF3343); In 80.25
cd01483143 E1_enzyme_family Superfamily of activating enzymes 80.11
PF02401281 LYTB: LytB protein; InterPro: IPR003451 Terpenes a 80.05
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information 
Probab=99.97  E-value=1.7e-30  Score=184.36  Aligned_cols=116  Identities=33%  Similarity=0.614  Sum_probs=104.3

Q ss_pred             ccccCCCChhHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCceeEEEEecCCChhhHHhhHHHHHHhCCCCEEEeCCHH
Q 033061            8 PKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQ   87 (128)
Q Consensus         8 p~~~P~~~~~~~~~i~~lL~~a~~ag~lv~G~~~v~kai~~~kakLVilA~D~~p~~~~~~l~~lc~~~~IP~~~~~sk~   87 (128)
                      |.+.|+.++ ++++++++|++|+++|++++|.++|+++|++|+++|||+|+|++|++++++++.+|++++|||++++|++
T Consensus         1 ~~~~~~~~~-l~~ki~~lL~la~ragkl~~G~~~v~kaikkgka~LVilA~D~s~~~~~~~i~~lc~~~~Ip~~~~~sk~   79 (117)
T TIGR03677         1 YVKFEVPEE-LANKALEAVEKARETGKIKKGTNEVTKAVERGIAKLVVIAEDVEPPEIVAHLPALCEEKGIPYVYVKKKE   79 (117)
T ss_pred             CCCCcCcHH-HHHHHHHHHHHHHHcCCEeEcHHHHHHHHHcCCccEEEEeCCCCcHHHHHHHHHHHHHcCCCEEEeCCHH
Confidence            346788666 9999999999999999999999999999999999999999999998688999999999999999999999


Q ss_pred             HHhHHhCCCCceEEEEEecCCchHHHHHHHHHHHHHhhh
Q 033061           88 ALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKL  126 (128)
Q Consensus        88 eLG~a~G~~~~~~~v~i~~~~~~~~~~li~~i~~~~~~~  126 (128)
                      |||++||+++++++++|+|.  ..-..+++++.+.|.+|
T Consensus        80 eLG~a~Gk~~~~svvaI~d~--g~a~~~~~~~~~~i~~~  116 (117)
T TIGR03677        80 DLGAAAGLEVGAASAAIVDE--GKAEELLKEIIEKVEAL  116 (117)
T ss_pred             HHHHHhCCCCCeEEEEEEch--hhhHHHHHHHHHHHHhc
Confidence            99999999988889999984  34445577788888776

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, box H/ACA, box C/D and box C'/D' sRNAs. Interacts with protein L15e.
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3167 consensus Box H/ACA snoRNP component, involved in ribosomal RNA pseudouridinylation [RNA processing and modification] Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3387 consensus 60S ribosomal protein 15 Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3166 consensus 60S ribosomal protein L7A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>PF15608 PELOTA_1: PELOTA RNA binding domain Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>cd01422 MGS Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 rRNA methylase, putative, group 3 Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>PRK05234 mgsA methylglyoxal synthase; Validated Back     alignment and domain information
>PF07997 DUF1694: Protein of unknown function (DUF1694); InterPro: IPR012543 This family contains many hypothetical proteins Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information
>COG1537 PelA Predicted RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PLN02821 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>PF02603 Hpr_kinase_N: HPr Serine kinase N terminus; InterPro: IPR011126 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01045 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed Back     alignment and domain information
>TIGR00216 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming) Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG0566 SpoU rRNA methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03618 Kinase-PPPase: Kinase/pyrophosphorylase; InterPro: IPR005177 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases Back     alignment and domain information
>PRK12360 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Provisional Back     alignment and domain information
>PF11823 DUF3343: Protein of unknown function (DUF3343); InterPro: IPR021778 This family of proteins are functionally uncharacterised Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF02401 LYTB: LytB protein; InterPro: IPR003451 Terpenes are among the largest groups of natural products and include compounds such as vitamins, cholesterol and carotenoids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2ale_A134 Crystal Structure Of Yeast Rna Splicing Factor Snu1 7e-44
1zwz_A126 Structural Comparison Of Yeast Snornp And Splicesom 7e-44
2ozb_A130 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 1e-43
2jnb_A144 Solution Structure Of Rna-Binding Protein 15.5k Len 1e-43
1e7k_A128 Crystal Structure Of The Spliceosomal 15.5kd Protei 1e-43
2aif_A135 Crystal Structure Of High Mobility Like Protein, Nh 5e-37
3o85_A122 Giardia Lamblia 15.5kd Rna Binding Protein Length = 5e-18
3paf_A117 M. Jannaschii L7ae Mutant Length = 117 5e-14
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 2e-11
1sds_A117 Structure Of Protein L7ae Bound To A K-Turn Derived 4e-11
1ra4_A120 Crystal Structure Of The Methanococcus Jannaschii L 5e-11
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 5e-11
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 7e-11
2lbx_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 2e-10
2lbw_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 2e-10
1s72_F120 Refined Crystal Structure Of The Haloarcula Marismo 5e-10
3g4s_F119 Co-Crystal Structure Of Tiamulin Bound To The Large 5e-10
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-08
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 9e-08
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 9e-08
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 9e-08
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 1e-07
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 1e-07
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 1e-07
>pdb|2ALE|A Chain A, Crystal Structure Of Yeast Rna Splicing Factor Snu13p Length = 134 Back     alignment and structure 
Iteration: 1

 Score =  171 bits (434), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 98/124 (79%)
Query: 5   AVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXX 64
           A NPKA+PLAD+ LT  ILD+VQQAAN +QLKKGANEATKTLNRGISEFI+MAAD     
Sbjct: 3   APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIE 62
Query: 65  XXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIE 124
                    EDKNVPYVFVPS+ ALGRACGV+RPVIA S+T+N+AS +KTQI  +KD IE
Sbjct: 63  ILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIE 122
Query: 125 KLLI 128
            LLI
Sbjct: 123 TLLI 126
>pdb|1ZWZ|A Chain A, Structural Comparison Of Yeast Snornp And Splicesomal Protein Snu13p With Its Homologs Length = 126 Back     alignment and structure
>pdb|2OZB|A Chain A, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 130 Back     alignment and structure
>pdb|2JNB|A Chain A, Solution Structure Of Rna-Binding Protein 15.5k Length = 144 Back     alignment and structure
>pdb|1E7K|A Chain A, Crystal Structure Of The Spliceosomal 15.5kd Protein Bound To A U4 Snrna Fragment Length = 128 Back     alignment and structure
>pdb|2AIF|A Chain A, Crystal Structure Of High Mobility Like Protein, Nhp2, Putative From Cryptosporidium Parvum Length = 135 Back     alignment and structure
>pdb|3O85|A Chain A, Giardia Lamblia 15.5kd Rna Binding Protein Length = 122 Back     alignment and structure
>pdb|3PAF|A Chain A, M. Jannaschii L7ae Mutant Length = 117 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|1SDS|A Chain A, Structure Of Protein L7ae Bound To A K-Turn Derived From An Archaeal Box HACA SRNA Length = 117 Back     alignment and structure
>pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein Length = 120 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|2LBX|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P Length = 121 Back     alignment and structure
>pdb|2LBW|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P-S82w Mutant Length = 121 Back     alignment and structure
>pdb|1S72|F Chain F, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 120 Back     alignment and structure
>pdb|3G4S|F Chain F, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 119 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 9e-47
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 2e-46
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 2e-45
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 2e-41
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 3e-33
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 1e-32
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 2e-32
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 2e-31
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 4e-30
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 1e-28
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 3e-24
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 6e-24
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 3e-23
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 2e-19
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 3e-18
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 4e-18
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 2e-12
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 9e-12
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 4e-11
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 8e-09
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 2e-08
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 4e-08
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 5e-08
1w41_A101 50S ribosomal protein L30E; electrostatic interact 5e-08
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 7e-08
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
 Score =  146 bits (370), Expect = 9e-47
 Identities = 97/125 (77%), Positives = 110/125 (88%)

Query: 4   EAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPL 63
            A NPKA+PLAD+ LT  ILD+VQQAAN +QLKKGANEATKTLNRGISEFI+MAAD EP+
Sbjct: 2   SAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPI 61

Query: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAI 123
           EILLHLPLL EDKNVPYVFVPS+ ALGRACGV+RPVIA S+T+N+AS +KTQI  +KD I
Sbjct: 62  EILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKI 121

Query: 124 EKLLI 128
           E LLI
Sbjct: 122 ETLLI 126
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Length = 143 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 100.0
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 100.0
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 100.0
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 100.0
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.97
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.96
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.96
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.96
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.95
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.95
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.95
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.95
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.94
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.94
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.94
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.94
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.94
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.93
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.93
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.9
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.9
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.87
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.85
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.85
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.85
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.84
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.8
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 99.55
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 99.48
3ir9_A166 Peptide chain release factor subunit 1; structural 96.5
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 95.32
3oby_A352 Protein pelota homolog; SM fold, hydrolase; 2.90A 94.62
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 94.33
2qi2_A347 Pelota, cell division protein pelota related prote 94.2
3nk6_A 277 23S rRNA methyltransferase; nosiheptide, nosihepti 94.13
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 93.8
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 93.55
1gz0_A 253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 93.41
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 92.49
3agk_A373 Peptide chain release factor subunit 1; translatio 92.33
3agj_B358 Protein pelota homolog; GTP binding, translation-h 91.66
3mca_B390 Protein DOM34, elongation factor 1 alpha-like prot 91.44
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 91.34
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 90.9
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 90.53
2vgn_A386 DOM34; translation termination factor, protein bio 89.85
2ohw_A133 YUEI protein; structural genomics, PSI-2, protein 89.39
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 88.76
1ipa_A 274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 87.72
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetic 86.47
2l82_A162 Designed protein OR32; structural genomics, northe 85.31
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 81.25
1x7o_A 287 Avirb, rRNA methyltransferase; SPOU, C-terminal kn 80.03
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
Probab=100.00  E-value=2.4e-38  Score=230.77  Aligned_cols=128  Identities=79%  Similarity=1.159  Sum_probs=124.7

Q ss_pred             CCCCCCCccccCCCChhHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCceeEEEEecCCChhhHHhhHHHHHHhCCCCE
Q 033061            1 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPY   80 (128)
Q Consensus         1 ~~~~~~~p~~~P~~~~~~~~~i~~lL~~a~~ag~lv~G~~~v~kai~~~kakLVilA~D~~p~~~~~~l~~lc~~~~IP~   80 (128)
                      |+..+++|+|+|+++.+++++++++|++|+++|+++.|.++|+++|++|+++|||+|+|++|.+++++++.+|++++|||
T Consensus        17 ~~~~~~~~~a~Pla~~~l~~ki~~~L~lA~kagkl~~G~kev~KaI~~gkakLVIIA~D~~p~e~~~~l~~lC~~~~VP~   96 (144)
T 2jnb_A           17 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY   96 (144)
T ss_dssp             CCCSCCCCCSSSBCCHHHHHHHHHHHHHHHHTTCCCBCHHHHHHHHHHTCEEEEEEETTCSCHHHHTTSCSSCGGGCCCC
T ss_pred             hccccCCcccCCCCCHHHHHHHHHHHHHHHHcCCccccHHHHHHHHHhCCCeEEEEeCCCCHHHHHHHHHHHHHHhCCCE
Confidence            67789999999999999999999999999999999999999999999999999999999999779999999999999999


Q ss_pred             EEeCCHHHHhHHhCCCCceEEEEEecCCchHHHHHHHHHHHHHhhhhC
Q 033061           81 VFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI  128 (128)
Q Consensus        81 ~~~~sk~eLG~a~G~~~~~~~v~i~~~~~~~~~~li~~i~~~~~~~~~  128 (128)
                      ++++|+.+||+|||+++++++++|+++++++|.++++++++.|+.||+
T Consensus        97 ~~v~sk~eLG~a~Gk~~~vs~vaI~~~~~s~i~~~~~~~~~~i~~l~~  144 (144)
T 2jnb_A           97 VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV  144 (144)
T ss_dssp             EEESCSHHHHHHHTCSSCCSEEEEECCTTCTTHHHHHHHHHHHHHHHC
T ss_pred             EEECCHHHHHHHhCCCCceEEEEEEeCCcHHHHHHHHHHHHHHHHHhC
Confidence            999999999999999999999999999999999999999999999986
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A 3izq_0 3j16_A* Back     alignment and structure
>2ohw_A YUEI protein; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.40A {Bacillus subtilis} SCOP: d.79.8.1 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1x7o_A Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 1e-44
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-41
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 7e-36
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 1e-29
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 2e-28
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 6e-28
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 5e-24
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 2e-18
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 4e-18
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 4e-15
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

 Score =  139 bits (352), Expect = 1e-44
 Identities = 97/125 (77%), Positives = 110/125 (88%)

Query: 4   EAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPL 63
            A NPKA+PLAD+ LT  ILD+VQQAAN +QLKKGANEATKTLNRGISEFI+MAAD EP+
Sbjct: 2   SAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPI 61

Query: 64  EILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAI 123
           EILLHLPLL EDKNVPYVFVPS+ ALGRACGV+RPVIA S+T+N+AS +KTQI  +KD I
Sbjct: 62  EILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKI 121

Query: 124 EKLLI 128
           E LLI
Sbjct: 122 ETLLI 126
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d2alea1126 Small nuclear ribonucleoprotein-associated protein 100.0
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 100.0
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 100.0
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.97
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.96
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.96
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.94
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.93
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.93
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.93
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 97.47
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 96.55
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 96.16
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 95.86
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 95.8
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophil 93.04
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 90.3
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [Ta 89.9
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima 88.39
d1knxa1132 HPr kinase/phoshatase HprK N-terminal domain {Myco 87.37
d1ko7a1129 HPr kinase/phoshatase HprK N-terminal domain {Stap 86.7
d2ohwa1128 Uncharacterized protein YueI {Bacillus subtilis [T 85.0
d2ioja1120 Hypothetical protein AF1212 {Archaeoglobus fulgidu 83.42
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=100.00  E-value=1.2e-36  Score=215.74  Aligned_cols=124  Identities=78%  Similarity=1.129  Sum_probs=120.4

Q ss_pred             CCCccccCCCChhHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCceeEEEEecCCChhhHHhhHHHHHHhCCCCEEEeC
Q 033061            5 AVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTEPLEILLHLPLLAEDKNVPYVFVP   84 (128)
Q Consensus         5 ~~~p~~~P~~~~~~~~~i~~lL~~a~~ag~lv~G~~~v~kai~~~kakLVilA~D~~p~~~~~~l~~lc~~~~IP~~~~~   84 (128)
                      +++|+|+|++++++++++++++++|+++|+++.|.++|+++|++|+++|||+|+|++|.++++|++.+|++++|||++++
T Consensus         3 ~~~~~a~P~a~~~l~~~i~~ll~~a~~~~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~Ip~~~v~   82 (126)
T d2alea1           3 APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVP   82 (126)
T ss_dssp             CCCTTCCSBCCHHHHHHHHHHHHHHHHTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEEEES
T ss_pred             CCCCccCCCCCHHHHHHHHHHHHHHHHcCCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCCCEEEEC
Confidence            68999999999999999999999999999999999999999999999999999999998899999999999999999999


Q ss_pred             CHHHHhHHhCCCCceEEEEEecCCchHHHHHHHHHHHHHhhhhC
Q 033061           85 SKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI  128 (128)
Q Consensus        85 sk~eLG~a~G~~~~~~~v~i~~~~~~~~~~li~~i~~~~~~~~~  128 (128)
                      |+.+||+|||+++++++++|.+++++++.++++++++++.+|.+
T Consensus        83 sk~~LG~a~G~~~~~~~~~i~~~~~~~~~~~~~~i~~~i~~L~~  126 (126)
T d2alea1          83 SRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI  126 (126)
T ss_dssp             CHHHHHHHTTCSSCCSEEEEECCTTCTTHHHHHHHHHHHHHHHH
T ss_pred             chhHHHHHhCCCCCeEEEEEeccchHHHHHHHHHHHHHHHhhcC
Confidence            99999999999999999999999999999999999999999864
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa1 c.98.2.1 (A:1-132) HPr kinase/phoshatase HprK N-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a1 c.98.2.1 (A:1-129) HPr kinase/phoshatase HprK N-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2ohwa1 d.79.8.1 (A:3-130) Uncharacterized protein YueI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ioja1 c.98.2.2 (A:206-325) Hypothetical protein AF1212 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure