Citrus Sinensis ID: 033062


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MEKSNNSSRTAKGTTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLLADRDSGLITPGSLRQNSALLGMGMDGMTKEDAEAMVREGDLDGDGALNETEFCILMVRLSPGMMQDAEAWLQKALDHQQQ
ccccccHHHcccccccccCCcHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHc
*******************EYEDLLPVMAEKLDVESFVSELCGGFRLLADRDSGLITPGSLRQNSALLGMGMDGMTKEDAEAMVREGDLDGDGALNETEFCILMVRLSPGMMQDAEAW***ALD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSNNSSRTAKGTTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLLADRDSGLITPGSLRQNSALLGMGMDGMTKEDAEAMVREGDLDGDGALNETEFCILMVRLSPGMMQDAEAWLQKALDHQQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-binding protein KIC Calcium-binding regulatory protein that interacts with kinesin motor protein KCBP in a calcium-dependent manner. Inhibits KCBP microtubule binding activity and microtubule-stimulated ATPase activitiy. Involved in the regulation of trichome branching through its interaction with KCBP.probableQ9ZPX9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H4S, chain E
Confidence level:very confident
Coverage over the Query: 31-125
View the alignment between query and template
View the model in PyMOL