Query         033066
Match_columns 128
No_of_seqs    109 out of 330
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:24:10 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033066.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033066hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399 Predicted Yippee-type  100.0   7E-54 1.5E-58  316.2  -3.0  119    1-119     1-120 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 6.2E-33 1.3E-37  193.9   6.1   89   14-108     2-94  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  95.9  0.0046   1E-07   45.5   1.8   88   14-103     4-93  (123)
  4 TIGR00357 methionine-R-sulfoxi  94.9    0.03 6.4E-07   42.4   3.3   68   12-86     38-105 (134)
  5 PRK00222 methionine sulfoxide   94.6   0.028 6.2E-07   42.9   2.7   87   12-109    41-127 (142)
  6 PF01641 SelR:  SelR domain;  I  94.5   0.031 6.7E-07   41.8   2.6   71   12-89     35-105 (124)
  7 PRK05508 methionine sulfoxide   93.8   0.071 1.5E-06   39.7   3.2   63   12-84     31-93  (119)
  8 PRK05550 bifunctional methioni  92.4    0.11 2.5E-06   43.5   2.8   64   12-85     34-97  (283)
  9 PRK14018 trifunctional thiored  91.6    0.18 3.9E-06   45.4   3.3   68   12-86    416-483 (521)
 10 PF14976 FAM72:  FAM72 protein   88.1     1.1 2.3E-05   34.7   4.6   77   13-101    14-103 (150)
 11 KOG0856 Predicted pilin-like t  88.0     0.8 1.7E-05   35.2   3.9   66   12-85     52-118 (146)
 12 COG0229 Conserved domain frequ  87.3    0.93   2E-05   34.7   3.9   65   12-83     40-104 (140)
 13 PF09814 HECT_2:  HECT-like Ubi  70.2     7.4 0.00016   32.2   4.2   17   14-30    106-122 (354)
 14 PF04828 GFA:  Glutathione-depe  54.2      13 0.00028   24.0   2.4   48   36-83     12-61  (92)
 15 PF13717 zinc_ribbon_4:  zinc-r  49.6      12 0.00025   21.9   1.4   19   14-32      2-20  (36)
 16 PRK02935 hypothetical protein;  49.1      12 0.00026   27.7   1.7   24   13-36     85-108 (110)
 17 COG4416 Com Mu-like prophage p  48.1     8.3 0.00018   25.5   0.7   15   13-27      3-17  (60)
 18 PF11023 DUF2614:  Protein of u  42.4      11 0.00023   28.1   0.6   25   13-37     84-108 (114)
 19 TIGR01053 LSD1 zinc finger dom  41.7      25 0.00054   20.2   1.9   20    4-23      9-28  (31)
 20 COG3791 Uncharacterized conser  39.5      20 0.00044   26.3   1.7   21   67-87     66-86  (133)
 21 COG1996 RPC10 DNA-directed RNA  37.3      29 0.00064   22.1   1.9   12   13-24      5-16  (49)
 22 TIGR00037 eIF_5A translation i  34.0      39 0.00086   25.0   2.5   30   36-65     35-64  (130)
 23 PF13465 zf-H2C2_2:  Zinc-finge  33.3      27 0.00059   18.6   1.1   15   10-24     10-24  (26)
 24 PF03811 Zn_Tnp_IS1:  InsA N-te  31.1      28 0.00061   20.6   1.0   27   69-95      4-31  (36)
 25 PF10955 DUF2757:  Protein of u  30.4      22 0.00048   24.6   0.6   16   14-29      4-19  (76)
 26 TIGR02820 formald_GSH S-(hydro  29.9      67  0.0014   25.4   3.3   30   54-84     74-103 (182)
 27 PF14803 Nudix_N_2:  Nudix N-te  29.4      26 0.00056   20.5   0.7   14   72-85      2-15  (34)
 28 PF00412 LIM:  LIM domain;  Int  26.9      34 0.00074   20.5   1.0   16   13-28     25-40  (58)
 29 PF06943 zf-LSD1:  LSD1 zinc fi  26.2      59  0.0013   17.9   1.7   20    3-22      5-24  (25)
 30 smart00661 RPOL9 RNA polymeras  25.5      81  0.0018   18.7   2.5   17   13-29     19-35  (52)
 31 KOG2462 C2H2-type Zn-finger pr  23.8      24 0.00053   29.9  -0.2   22   10-31    211-232 (279)
 32 PF00096 zf-C2H2:  Zinc finger,  23.6      14  0.0003   18.5  -1.1   16   15-30      1-16  (23)
 33 smart00132 LIM Zinc-binding do  23.0      34 0.00074   18.4   0.4   13   13-25     26-38  (39)
 34 PF13842 Tnp_zf-ribbon_2:  DDE_  23.0      69  0.0015   18.2   1.7   15   13-27     15-29  (32)
 35 PF10058 DUF2296:  Predicted in  22.9      25 0.00055   22.4  -0.2   35   45-84      2-36  (54)
 36 PLN03107 eukaryotic translatio  22.8      96  0.0021   23.9   2.9   31   36-66     49-79  (159)
 37 PF13912 zf-C2H2_6:  C2H2-type   22.5      12 0.00025   19.6  -1.6   18   14-31      1-18  (27)
 38 PRK11586 napB nitrate reductas  22.5      52  0.0011   25.5   1.4   28   12-39    118-145 (149)
 39 PF00645 zf-PARP:  Poly(ADP-rib  22.1      89  0.0019   20.5   2.4   32    8-40      2-33  (82)
 40 PRK05417 glutathione-dependent  21.9   1E+02  0.0022   24.5   3.0   40   67-110    90-129 (191)
 41 PF06397 Desulfoferrod_N:  Desu  21.5      53  0.0012   19.6   1.0   12   13-24      5-16  (36)
 42 PF13248 zf-ribbon_3:  zinc-rib  21.3      29 0.00062   18.7  -0.2   11   70-80     16-26  (26)
 43 PRK03999 translation initiatio  21.0 1.1E+02  0.0025   22.5   2.9   30   36-65     34-63  (129)
 44 cd02669 Peptidase_C19M A subfa  21.0      64  0.0014   27.9   1.8   53    9-81     23-77  (440)
 45 KOG2324 Prolyl-tRNA synthetase  20.7      78  0.0017   28.4   2.3   13   79-91    271-283 (457)
 46 PF11682 DUF3279:  Protein of u  20.2      56  0.0012   24.6   1.1   67   13-79     27-106 (128)
 47 PF13240 zinc_ribbon_2:  zinc-r  20.2      32 0.00069   18.3  -0.1   10   71-80     14-23  (23)

No 1  
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=100.00  E-value=7e-54  Score=316.18  Aligned_cols=119  Identities=49%  Similarity=0.879  Sum_probs=116.0

Q ss_pred             CcceeeeccCCc-cEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCe
Q 033066            1 MGRIFLVELKGR-SYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQI   79 (128)
Q Consensus         1 MG~~f~~yl~g~-~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~   79 (128)
                      |||+|..+|++. +.|+|++|+||||.++|||||+|+|++|+||||++|+||..|+.|+|.|+||+|+|+||+|+.|++.
T Consensus         1 mgR~F~~~l~~~~~~y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~~   80 (122)
T KOG3399|consen    1 MGRLFEAMLEANHRLYSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGTG   80 (122)
T ss_pred             CcchHHHHhccCCceEeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCCC
Confidence            999999999984 7999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeEEEEeccCCcceeCCeEEEEeeceeeecccccccccc
Q 033066           80 VGWKYVAAHDKNQKYKEGKFVLERWRIVEEVTEELSLETH  119 (128)
Q Consensus        80 lGWkY~~A~e~sqkYKEGkfILE~~~i~~~~g~~~~~~~~  119 (128)
                      |||||+.|||+||||||||||||+++|.+++|++.|+.++
T Consensus        81 ~GWkYe~a~e~sQkyKEGk~ilE~~~i~~~~g~~~~~~~~  120 (122)
T KOG3399|consen   81 LGWKYEHAYEKSQKYKEGKFILELAEIFKPEGWDLEVGAL  120 (122)
T ss_pred             cceeeeeccCchhhhcCcchHHHHHHhcCCCCchhhcCCC
Confidence            9999999999999999999999999999999999998654


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=99.98  E-value=6.2e-33  Score=193.90  Aligned_cols=89  Identities=45%  Similarity=0.915  Sum_probs=85.3

Q ss_pred             EEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeecc----EEEeeeeeeecCCeeeeEEEEecc
Q 033066           14 YYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGM----HTVEDIFCCCCGQIVGWKYVAAHD   89 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~----H~V~DI~C~~C~~~lGWkY~~A~e   89 (128)
                      +|.|++|++||+++++|+|  |+|+.|+||||+   ||..+++++|.|+||.    |+|+||+|++|++.|||||++|++
T Consensus         2 vf~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~   76 (96)
T PF03226_consen    2 VFQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPE   76 (96)
T ss_pred             EEECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCH
Confidence            7999999999999999999  999999999998   7778888999999999    999999999999999999999999


Q ss_pred             CCcceeCCeEEEEeeceee
Q 033066           90 KNQKYKEGKFVLERWRIVE  108 (128)
Q Consensus        90 ~sqkYKEGkfILE~~~i~~  108 (128)
                      + |+||||+||||++.|..
T Consensus        77 ~-~~~k~g~file~~~i~~   94 (96)
T PF03226_consen   77 E-QKYKEGKFILEKASISS   94 (96)
T ss_pred             h-HhhhCCEEEEEhhHEEE
Confidence            9 99999999999999863


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=95.90  E-value=0.0046  Score=45.55  Aligned_cols=88  Identities=17%  Similarity=0.165  Sum_probs=57.4

Q ss_pred             EEeccCCCCcccCCCCeeeeccccC--CCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEEEeccCC
Q 033066           14 YYKCRFCNSHLALADSVLSWSFNCR--RGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKN   91 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~lISk~F~G~--~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e~s   91 (128)
                      .+-|++|.+.++..+||-.-.-+..  -.+.  |...+.+...|++.....-+.+....|+|..|++.+|-.+..---+=
T Consensus         4 ~llC~kC~~~~C~~~DIr~ie~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~~L   81 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKIENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGVEL   81 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEETTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTEEE
T ss_pred             EEECCCCCceeEchhheEEecCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCccc
Confidence            5889999999999999876521100  0112  22455556665554445557889999999999999998776543334


Q ss_pred             cceeCCeEEEEe
Q 033066           92 QKYKEGKFVLER  103 (128)
Q Consensus        92 qkYKEGkfILE~  103 (128)
                      .-.|.-.|+++.
T Consensus        82 P~L~iksfvv~~   93 (123)
T PF11648_consen   82 PCLKIKSFVVEL   93 (123)
T ss_dssp             EEE-GGGEEEEE
T ss_pred             cEEEeeeeeeee
Confidence            455555666443


No 4  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.88  E-value=0.03  Score=42.44  Aligned_cols=68  Identities=15%  Similarity=0.339  Sum_probs=42.2

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEEE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVA   86 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~   86 (128)
                      +-+|.|+.|.++|-.+++    .|....|=.-.+..+-.-.+...+|..  -|+.. ..|.|..|+.+||--...
T Consensus        38 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~D  105 (134)
T TIGR00357        38 EGIYVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEVVAYERDES--HGMIR-TEVRCRNCDAHLGHVFDD  105 (134)
T ss_pred             CeEEEccCCCCccccccc----hhcCCCCCcCcCcccCCCceEEeecCC--CCcEE-EEEEecCCCCccCcccCC
Confidence            358999999999987764    355555544434444111122233322  24444 579999999999975543


No 5  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=94.64  E-value=0.028  Score=42.94  Aligned_cols=87  Identities=14%  Similarity=0.304  Sum_probs=50.3

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEEEeccCC
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKN   91 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e~s   91 (128)
                      +-+|.|+.|.++|=.+++    .|....|=.-.+..+-.-.+...+|+  .-|+.. ..|.|..|+.+||--......++
T Consensus        41 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~V~~~~D~--s~gm~R-tEv~C~~Cg~HLGHVF~DGP~pt  113 (142)
T PRK00222         41 KGIYVCIVCGEPLFSSDT----KFDSGCGWPSFTKPIDEEAIRELRDT--SHGMVR-TEVRCANCDSHLGHVFPDGPKPT  113 (142)
T ss_pred             CeEEEecCCCchhcCCcc----cccCCCCCcCcCcccCCCceEEeecc--CCCceE-EEEEeCCCCCccCcccCCCCCCC
Confidence            458999999999987743    46656665444444422122222332  223322 57999999999998664432221


Q ss_pred             cceeCCeEEEEeeceeee
Q 033066           92 QKYKEGKFVLERWRIVEE  109 (128)
Q Consensus        92 qkYKEGkfILE~~~i~~~  109 (128)
                          -=+|-|.-+-|.-.
T Consensus       114 ----g~RyCINs~sL~F~  127 (142)
T PRK00222        114 ----GLRYCINSASLKFI  127 (142)
T ss_pred             ----CCEeeeceeeEEee
Confidence                11565555555443


No 6  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=94.52  E-value=0.031  Score=41.77  Aligned_cols=71  Identities=20%  Similarity=0.436  Sum_probs=43.2

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEEEecc
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHD   89 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e   89 (128)
                      +-+|.|+.|.++|=.++.    .|....|=.-.+..+..-.+....|..  -|+. -..|.|..|+.+||=-......
T Consensus        35 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~v~~~~D~s--~g~~-R~Ev~C~~Cg~HLGHVF~DGp~  105 (124)
T PF01641_consen   35 EGIYVCAVCGTPLFSSDT----KFDSGCGWPSFWQPIPGDAVKEREDFS--HGMV-RTEVRCARCGSHLGHVFDDGPP  105 (124)
T ss_dssp             SEEEEETTTS-EEEEGGG----EETSSSSSSEESSCSSTTSEEEEEEEC--TSSE-EEEEEETTTCCEEEEEESTSST
T ss_pred             CEEEEcCCCCCccccCcc----cccCCcCCccccCcCChHHEEEecccc--CCce-EEEEEecCCCCccccEeCCCCC
Confidence            458999999999976653    465555554434443332222233322  2444 4478999999999986665444


No 7  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=93.76  E-value=0.071  Score=39.71  Aligned_cols=63  Identities=19%  Similarity=0.468  Sum_probs=42.1

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKY   84 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY   84 (128)
                      +-+|.|+.|.++|=.+++    .|....|=.-.+..+-| .+...+|..   | + =..|.|+.|+.+||--.
T Consensus        31 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~-~v~~~~D~~---~-~-RtEv~C~~C~~HLGHVF   93 (119)
T PRK05508         31 KGTYVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKG-AVKRIPDAD---G-R-RTEIVCANCGGHLGHVF   93 (119)
T ss_pred             CeEEEecCCCCccccccc----cccCCCCCcccCccccc-ceEEEecCC---C-c-EEEEEeCCCCCccCccc
Confidence            358999999999987764    46666665444555533 223334433   2 2 46799999999999744


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=92.36  E-value=0.11  Score=43.50  Aligned_cols=64  Identities=22%  Similarity=0.461  Sum_probs=42.3

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYV   85 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~   85 (128)
                      +-+|.|+.|+++|=.+++    .|....|=.-.+..+-|-.. ..++..   |+  =..|.|..|+.+||--..
T Consensus        34 ~G~y~c~~c~~~LF~s~~----Kf~sg~GWPsF~~~~~~~~~-~~~d~~---~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         34 KGVYLCRRCGAPLFRSED----KFNSGCGWPSFDDEIPGAVK-RLPDAD---GR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             CcEEEcCCCCchhcCChh----hccCCCCCcCcCcccCCccE-EEEcCC---Cc--eEEEEecCCCCccCcccC
Confidence            358999999999987654    46555665444555544322 222222   33  478999999999998654


No 9  
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=91.58  E-value=0.18  Score=45.45  Aligned_cols=68  Identities=7%  Similarity=0.069  Sum_probs=43.2

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEEEE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVA   86 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~   86 (128)
                      +-+|.|+.|+++|=+++    ..|....|=.-.+..+-+-.+....|.  .-|++. ..|.|..|+.+||-....
T Consensus       416 ~G~y~c~~c~~pLf~s~----~Kf~sg~GWPsF~~~i~~~~v~~~~d~--s~g~~R-~Ev~c~~c~~HLGHvf~d  483 (521)
T PRK14018        416 PGIYVDVVSGEPLFSSA----DKYDSGCGWPSFTRPIDAKVVTEHDDF--SYNMRR-TEVRSRAADSHLGHVFPD  483 (521)
T ss_pred             CEEEEecCCCCccccCc----ccccCCCCCcccCcccCcCceEEeecc--CCCceE-EEEEECCCCCcCCcccCC
Confidence            46999999999998875    346656665443444432222222332  224444 379999999999986644


No 10 
>PF14976 FAM72:  FAM72 protein
Probab=88.11  E-value=1.1  Score=34.75  Aligned_cols=77  Identities=30%  Similarity=0.565  Sum_probs=46.7

Q ss_pred             cEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccC----Ccccceeeeecc--------EEEeeeeeeecCCee
Q 033066           13 SYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIML----GPQEERLMLSGM--------HTVEDIFCCCCGQIV   80 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~----g~~e~r~m~TG~--------H~V~DI~C~~C~~~l   80 (128)
                      .+..|+.|.+-|+...           =||.|..+ .|+.+    -||....-.+|.        =.++|+-|..|+..|
T Consensus        14 ~~L~C~~C~~~l~~Rg-----------MkAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~v   81 (150)
T PF14976_consen   14 YILCCKFCDQVLCNRG-----------MKAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIV   81 (150)
T ss_pred             EEEECCCCCchhccch-----------hhheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCee
Confidence            3689999999887533           24666554 33332    122222222333        369999999999999


Q ss_pred             eeEEEEeccC-CcceeCCeEEE
Q 033066           81 GWKYVAAHDK-NQKYKEGKFVL  101 (128)
Q Consensus        81 GWkY~~A~e~-sqkYKEGkfIL  101 (128)
                      |+..+..=.. -+.-.-|.|-+
T Consensus        82 GYhV~~PC~~Cl~scNNGH~wm  103 (150)
T PF14976_consen   82 GYHVVVPCSRCLSSCNNGHFWM  103 (150)
T ss_pred             eeEEEEEcchHhcCccCCceEE
Confidence            9988765321 12234666665


No 11 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=88.01  E-value=0.8  Score=35.25  Aligned_cols=66  Identities=20%  Similarity=0.397  Sum_probs=38.3

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceee-eeccEEEeeeeeeecCCeeeeEEE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLM-LSGMHTVEDIFCCCCGQIVGWKYV   85 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m-~TG~H~V~DI~C~~C~~~lGWkY~   85 (128)
                      +-+|.|..|.++|-.+.    .-|....|=--.|+.+ +  .|....+.. .-|.| =.+|.|..|+.+||--.+
T Consensus        52 ~GvY~C~~C~~pLykS~----tKfdsgcGWPAF~e~i-~--~gaI~r~~d~s~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   52 EGVYVCAGCGTPLYKST----TKFDSGCGWPAFFEAI-G--PGAITRTPDNSRGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CceEEEeecCCcccccc----ccccCCCCCchhhhcc-C--CCceeeccccCCCCc-ceEEEEeecCCceeeeec
Confidence            46999999999997764    3465555542223332 1  222111111 11222 357899999999997543


No 12 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=87.27  E-value=0.93  Score=34.72  Aligned_cols=65  Identities=20%  Similarity=0.431  Sum_probs=41.5

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCCCeEEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeE
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWK   83 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWk   83 (128)
                      +-+|.|+.|..+|=.+++    .|....|=--.+..+..-.+...+|+  .-|++.+ .|.|..|+++||--
T Consensus        40 ~GiY~c~~cg~pLF~S~~----KfdSgcGWPSF~~pi~~~~I~~~~D~--S~gM~Rt-EVrc~~c~sHLGHV  104 (140)
T COG0229          40 KGIYVCIVCGEPLFSSED----KFDSGCGWPSFTKPISPDAITYKEDR--SHGMVRT-EVRCANCDSHLGHV  104 (140)
T ss_pred             CceEEeecCCCccccccc----cccCCCCCccccccCCcccceEeecc--CCCcEEE-EEEecCCCCccccc
Confidence            359999999999987765    35555554333444433333333342  3355543 68999999999963


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=70.17  E-value=7.4  Score=32.16  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.8

Q ss_pred             EEeccCCCCcccCCCCe
Q 033066           14 YYKCRFCNSHLALADSV   30 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~l   30 (128)
                      .+.|++|++.|.....+
T Consensus       106 ~~~C~~C~~~li~~~~~  122 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRNF  122 (354)
T ss_pred             EEECCCCCCcccCcccc
Confidence            69999999999766543


No 14 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=54.18  E-value=13  Score=24.04  Aligned_cols=48  Identities=17%  Similarity=0.151  Sum_probs=22.7

Q ss_pred             ccCCCeEEEeecccccc--CCcccceeeeeccEEEeeeeeeecCCeeeeE
Q 033066           36 NCRRGRAYLFSDVVNIM--LGPQEERLMLSGMHTVEDIFCCCCGQIVGWK   83 (128)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~--~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWk   83 (128)
                      .|..-.++++-..-++.  .|+..-+........+.-.+|..|++.|.+.
T Consensus        12 ~g~~~~~~~~~~~~~~~~~~g~~~l~~y~~s~~~~~r~FC~~CGs~l~~~   61 (92)
T PF04828_consen   12 SGSPFSAWAIVPKDDFRWTSGSENLKEYQFSGKGVERYFCPTCGSPLFSE   61 (92)
T ss_dssp             TT-SSEEEEEEEGGGEEEEE-GGGEEEC--TTSSCEEEEETTT--EEEEE
T ss_pred             cCCceeeEEEEcccceEEeeccccceEEEeCCCcCcCcccCCCCCeeecc
Confidence            33333344433333444  3444333333233445568999999999975


No 15 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=49.58  E-value=12  Score=21.91  Aligned_cols=19  Identities=16%  Similarity=0.510  Sum_probs=14.3

Q ss_pred             EEeccCCCCcccCCCCeee
Q 033066           14 YYKCRFCNSHLALADSVLS   32 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~lIS   32 (128)
                      .+.|.+|++-....++.|.
T Consensus         2 ~i~Cp~C~~~y~i~d~~ip   20 (36)
T PF13717_consen    2 IITCPNCQAKYEIDDEKIP   20 (36)
T ss_pred             EEECCCCCCEEeCCHHHCC
Confidence            4678888888877777664


No 16 
>PRK02935 hypothetical protein; Provisional
Probab=49.13  E-value=12  Score=27.65  Aligned_cols=24  Identities=29%  Similarity=0.488  Sum_probs=20.7

Q ss_pred             cEEeccCCCCcccCCCCeeeeccc
Q 033066           13 SYYKCRFCNSHLALADSVLSWSFN   36 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~~lISk~F~   36 (128)
                      |+..|-+|+++|+...++--|.|.
T Consensus        85 rvD~CM~C~~PLTLd~~legkefd  108 (110)
T PRK02935         85 RVDACMHCNQPLTLDRSLEGKEFD  108 (110)
T ss_pred             ceeecCcCCCcCCcCccccccCcC
Confidence            789999999999999888777664


No 17 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=48.07  E-value=8.3  Score=25.47  Aligned_cols=15  Identities=40%  Similarity=0.609  Sum_probs=11.5

Q ss_pred             cEEeccCCCCcccCC
Q 033066           13 SYYKCRFCNSHLALA   27 (128)
Q Consensus        13 ~~y~C~~C~thLa~~   27 (128)
                      +..+|++|..-||-.
T Consensus         3 ~tiRC~~CnKlLa~a   17 (60)
T COG4416           3 QTIRCAKCNKLLAEA   17 (60)
T ss_pred             eeeehHHHhHHHHhc
Confidence            568899998877754


No 18 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=42.43  E-value=11  Score=28.06  Aligned_cols=25  Identities=24%  Similarity=0.384  Sum_probs=21.4

Q ss_pred             cEEeccCCCCcccCCCCeeeecccc
Q 033066           13 SYYKCRFCNSHLALADSVLSWSFNC   37 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~~lISk~F~G   37 (128)
                      +...|-+|+++|+...++--|.|.-
T Consensus        84 r~D~CM~C~~pLTLd~~legkef~~  108 (114)
T PF11023_consen   84 RVDACMHCKEPLTLDPSLEGKEFDE  108 (114)
T ss_pred             hhhccCcCCCcCccCchhhcchhhH
Confidence            5689999999999999988887753


No 19 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=41.66  E-value=25  Score=20.17  Aligned_cols=20  Identities=25%  Similarity=0.620  Sum_probs=15.0

Q ss_pred             eeeeccCCccEEeccCCCCc
Q 033066            4 IFLVELKGRSYYKCRFCNSH   23 (128)
Q Consensus         4 ~f~~yl~g~~~y~C~~C~th   23 (128)
                      .-+.|..|-+.+.|..|++.
T Consensus         9 t~L~yP~gA~~vrCs~C~~v   28 (31)
T TIGR01053         9 TLLMYPRGASSVRCALCQTV   28 (31)
T ss_pred             cEeecCCCCCeEECCCCCeE
Confidence            45677788788888888764


No 20 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=39.50  E-value=20  Score=26.27  Aligned_cols=21  Identities=24%  Similarity=0.540  Sum_probs=16.0

Q ss_pred             EEeeeeeeecCCeeeeEEEEe
Q 033066           67 TVEDIFCCCCGQIVGWKYVAA   87 (128)
Q Consensus        67 ~V~DI~C~~C~~~lGWkY~~A   87 (128)
                      .+.-.||..|+++|-|+....
T Consensus        66 ~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          66 SAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCeecccCCCceEEecCCC
Confidence            344449999999999986544


No 21 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=37.31  E-value=29  Score=22.07  Aligned_cols=12  Identities=33%  Similarity=0.791  Sum_probs=10.6

Q ss_pred             cEEeccCCCCcc
Q 033066           13 SYYKCRFCNSHL   24 (128)
Q Consensus        13 ~~y~C~~C~thL   24 (128)
                      ..|.|..|+..+
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            579999999988


No 22 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=34.04  E-value=39  Score=24.97  Aligned_cols=30  Identities=20%  Similarity=0.118  Sum_probs=25.0

Q ss_pred             ccCCCeEEEeeccccccCCcccceeeeecc
Q 033066           36 NCRRGRAYLFSDVVNIMLGPQEERLMLSGM   65 (128)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~   65 (128)
                      .|+||.|+.--.+.|+..|..-+..+.++-
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~   64 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTS   64 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCC
Confidence            689999999999999999988776665554


No 23 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=33.28  E-value=27  Score=18.60  Aligned_cols=15  Identities=33%  Similarity=0.990  Sum_probs=11.6

Q ss_pred             CCccEEeccCCCCcc
Q 033066           10 KGRSYYKCRFCNSHL   24 (128)
Q Consensus        10 ~g~~~y~C~~C~thL   24 (128)
                      .|++.|.|..|..-.
T Consensus        10 ~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen   10 TGEKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSSSEEESSSSEEE
T ss_pred             CCCCCCCCCCCcCee
Confidence            467889999997543


No 24 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=31.06  E-value=28  Score=20.55  Aligned_cols=27  Identities=22%  Similarity=0.337  Sum_probs=21.0

Q ss_pred             eeeeeeecCCee-eeEEEEeccCCccee
Q 033066           69 EDIFCCCCGQIV-GWKYVAAHDKNQKYK   95 (128)
Q Consensus        69 ~DI~C~~C~~~l-GWkY~~A~e~sqkYK   95 (128)
                      -+|.|..|++.- --|.-+.-.-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            378999999988 677777777777774


No 25 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=30.39  E-value=22  Score=24.56  Aligned_cols=16  Identities=31%  Similarity=0.845  Sum_probs=13.4

Q ss_pred             EEeccCCCCcccCCCC
Q 033066           14 YYKCRFCNSHLALADS   29 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~   29 (128)
                      .|.|++|++.+..-+.
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            4999999999877655


No 26 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=29.89  E-value=67  Score=25.38  Aligned_cols=30  Identities=10%  Similarity=0.135  Sum_probs=17.9

Q ss_pred             CcccceeeeeccEEEeeeeeeecCCeeeeEE
Q 033066           54 GPQEERLMLSGMHTVEDIFCCCCGQIVGWKY   84 (128)
Q Consensus        54 g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY   84 (128)
                      |...-+....+.+.. --||..|++.|-++.
T Consensus        74 G~~~l~~Y~ss~~~~-R~FC~~CGS~L~~~~  103 (182)
T TIGR02820        74 NGDKLKVVDASATIQ-RHACKGCGTHMYGRI  103 (182)
T ss_pred             CCcceEEEeCCCCEE-eecCCCCCCcccccc
Confidence            444333333444444 449999999996544


No 27 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=29.43  E-value=26  Score=20.50  Aligned_cols=14  Identities=29%  Similarity=0.646  Sum_probs=7.1

Q ss_pred             eeeecCCeeeeEEE
Q 033066           72 FCCCCGQIVGWKYV   85 (128)
Q Consensus        72 ~C~~C~~~lGWkY~   85 (128)
                      ||.+|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            79999999988775


No 28 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=26.87  E-value=34  Score=20.49  Aligned_cols=16  Identities=31%  Similarity=0.663  Sum_probs=13.2

Q ss_pred             cEEeccCCCCcccCCC
Q 033066           13 SYYKCRFCNSHLALAD   28 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~   28 (128)
                      .-|.|..|+.+|...+
T Consensus        25 ~Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   25 ECFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TTSBETTTTCBTTTSS
T ss_pred             cccccCCCCCccCCCe
Confidence            4589999999997766


No 29 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=26.24  E-value=59  Score=17.95  Aligned_cols=20  Identities=25%  Similarity=0.663  Sum_probs=14.9

Q ss_pred             ceeeeccCCccEEeccCCCC
Q 033066            3 RIFLVELKGRSYYKCRFCNS   22 (128)
Q Consensus         3 ~~f~~yl~g~~~y~C~~C~t   22 (128)
                      |..+.|..|-+.-.|+.|++
T Consensus         5 r~~L~yp~GA~sVrCa~C~~   24 (25)
T PF06943_consen    5 RTLLMYPRGAPSVRCACCHT   24 (25)
T ss_pred             CceEEcCCCCCCeECCccCc
Confidence            45567888877788888875


No 30 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=25.52  E-value=81  Score=18.73  Aligned_cols=17  Identities=18%  Similarity=0.511  Sum_probs=12.8

Q ss_pred             cEEeccCCCCcccCCCC
Q 033066           13 SYYKCRFCNSHLALADS   29 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~~   29 (128)
                      ..|.|..|.-+......
T Consensus        19 ~~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       19 RRFVCRKCGYEEPIEQK   35 (52)
T ss_pred             CEEECCcCCCeEECCCc
Confidence            47999999987665555


No 31 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=23.82  E-value=24  Score=29.85  Aligned_cols=22  Identities=18%  Similarity=0.483  Sum_probs=18.5

Q ss_pred             CCccEEeccCCCCcccCCCCee
Q 033066           10 KGRSYYKCRFCNSHLALADSVL   31 (128)
Q Consensus        10 ~g~~~y~C~~C~thLa~~~~lI   31 (128)
                      .|++.|.|.+|+.-+|..+.|-
T Consensus       211 TGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  211 TGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             cCCCCccCCcccchhcchHHHH
Confidence            5789999999998888877664


No 32 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=23.61  E-value=14  Score=18.49  Aligned_cols=16  Identities=25%  Similarity=0.796  Sum_probs=11.9

Q ss_pred             EeccCCCCcccCCCCe
Q 033066           15 YKCRFCNSHLALADSV   30 (128)
Q Consensus        15 y~C~~C~thLa~~~~l   30 (128)
                      |.|..|+..+...++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899998877765544


No 33 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.03  E-value=34  Score=18.43  Aligned_cols=13  Identities=31%  Similarity=0.805  Sum_probs=11.0

Q ss_pred             cEEeccCCCCccc
Q 033066           13 SYYKCRFCNSHLA   25 (128)
Q Consensus        13 ~~y~C~~C~thLa   25 (128)
                      .-|.|..|+..|+
T Consensus        26 ~Cf~C~~C~~~L~   38 (39)
T smart00132       26 ECFKCSKCGKPLG   38 (39)
T ss_pred             cCCCCcccCCcCc
Confidence            4599999999886


No 34 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=22.99  E-value=69  Score=18.22  Aligned_cols=15  Identities=27%  Similarity=0.711  Sum_probs=12.6

Q ss_pred             cEEeccCCCCcccCC
Q 033066           13 SYYKCRFCNSHLALA   27 (128)
Q Consensus        13 ~~y~C~~C~thLa~~   27 (128)
                      ..|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            579999999988764


No 35 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=22.89  E-value=25  Score=22.42  Aligned_cols=35  Identities=17%  Similarity=0.412  Sum_probs=23.7

Q ss_pred             eeccccccCCcccceeeeeccEEEeeeeeeecCCeeeeEE
Q 033066           45 FSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKY   84 (128)
Q Consensus        45 f~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY   84 (128)
                      |++++.+..|..+     |+...--.+-|.+|.++=|---
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~   36 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAP   36 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccc
Confidence            5677888887766     3333333456999999988743


No 36 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=22.83  E-value=96  Score=23.86  Aligned_cols=31  Identities=19%  Similarity=0.263  Sum_probs=26.2

Q ss_pred             ccCCCeEEEeeccccccCCcccceeeeeccE
Q 033066           36 NCRRGRAYLFSDVVNIMLGPQEERLMLSGMH   66 (128)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~H   66 (128)
                      .|+||.|+.--.+.|+..|...+..+.++--
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~~   79 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSHN   79 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCCE
Confidence            7999999999999999999988877766553


No 37 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=22.54  E-value=12  Score=19.59  Aligned_cols=18  Identities=11%  Similarity=0.431  Sum_probs=13.1

Q ss_pred             EEeccCCCCcccCCCCee
Q 033066           14 YYKCRFCNSHLALADSVL   31 (128)
Q Consensus        14 ~y~C~~C~thLa~~~~lI   31 (128)
                      +|.|..|+.-+.+...++
T Consensus         1 ~~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALR   18 (27)
T ss_dssp             SEEETTTTEEESSHHHHH
T ss_pred             CCCCCccCCccCChhHHH
Confidence            488999998776655543


No 38 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=22.51  E-value=52  Score=25.51  Aligned_cols=28  Identities=18%  Similarity=0.317  Sum_probs=24.3

Q ss_pred             ccEEeccCCCCcccCCCCeeeeccccCC
Q 033066           12 RSYYKCRFCNSHLALADSVLSWSFNCRR   39 (128)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~   39 (128)
                      ++.|-|..|+.+=+...-|+.-.|....
T Consensus       118 prRYfCtQCHVPQada~PLV~N~F~~~~  145 (149)
T PRK11586        118 PRRYFCLQCHVPQADTAPIVGNTFTPSK  145 (149)
T ss_pred             ccceeeccccCccccCccCCCCCccchh
Confidence            5789999999999999999998887543


No 39 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=22.09  E-value=89  Score=20.50  Aligned_cols=32  Identities=19%  Similarity=0.283  Sum_probs=22.3

Q ss_pred             ccCCccEEeccCCCCcccCCCCeeeeccccCCC
Q 033066            8 ELKGRSYYKCRFCNSHLALADSVLSWSFNCRRG   40 (128)
Q Consensus         8 yl~g~~~y~C~~C~thLa~~~~lISk~F~G~~G   40 (128)
                      |-.+.| =.|+.|+..++..+--|.+-+....+
T Consensus         2 yAks~R-a~Ck~C~~~I~kg~lRiG~~~~~~~~   33 (82)
T PF00645_consen    2 YAKSGR-AKCKGCKKKIAKGELRIGKIVPSPEG   33 (82)
T ss_dssp             E-SSST-EBETTTSCBE-TTSEEEEEEEEETTS
T ss_pred             cCCCCC-ccCcccCCcCCCCCEEEEEEeccccc
Confidence            444434 38999999999888878776666655


No 40 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=21.85  E-value=1e+02  Score=24.49  Aligned_cols=40  Identities=15%  Similarity=0.016  Sum_probs=25.6

Q ss_pred             EEeeeeeeecCCeeeeEEEEeccCCcceeCCeEEEEeeceeeec
Q 033066           67 TVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRIVEEV  110 (128)
Q Consensus        67 ~V~DI~C~~C~~~lGWkY~~A~e~sqkYKEGkfILE~~~i~~~~  110 (128)
                      .+.--||..|++.|-+.++..-.    --.|..+|-...+-...
T Consensus        90 ~i~R~FC~~CGS~L~~~~e~~~~----~~pgl~fV~~gllDd~~  129 (191)
T PRK05417         90 TIQRHACKECGVHMYGRIENKDH----PFYGLDFVHTELSQEQG  129 (191)
T ss_pred             CeEeeeCCCCCCccccccccccC----CCCCeEEEehhhcCCCC
Confidence            35555999999999887662200    12377777776665543


No 41 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=21.51  E-value=53  Score=19.56  Aligned_cols=12  Identities=33%  Similarity=1.124  Sum_probs=7.4

Q ss_pred             cEEeccCCCCcc
Q 033066           13 SYYKCRFCNSHL   24 (128)
Q Consensus        13 ~~y~C~~C~thL   24 (128)
                      .+|.|.+|.+-+
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            589999998754


No 42 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=21.33  E-value=29  Score=18.67  Aligned_cols=11  Identities=36%  Similarity=0.872  Sum_probs=6.6

Q ss_pred             eeeeeecCCee
Q 033066           70 DIFCCCCGQIV   80 (128)
Q Consensus        70 DI~C~~C~~~l   80 (128)
                      +-||..|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            45677776643


No 43 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=21.02  E-value=1.1e+02  Score=22.49  Aligned_cols=30  Identities=13%  Similarity=0.073  Sum_probs=23.6

Q ss_pred             ccCCCeEEEeeccccccCCcccceeeeecc
Q 033066           36 NCRRGRAYLFSDVVNIMLGPQEERLMLSGM   65 (128)
Q Consensus        36 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~   65 (128)
                      .|+||.|+.--.+.|+..|...++...++-
T Consensus        34 pGkhg~a~vr~k~knL~tG~~~e~~~~s~d   63 (129)
T PRK03999         34 PGKHGSAKARIVAIGIFDGQKRSLVQPVDA   63 (129)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            688899998889999998887666655553


No 44 
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=21.02  E-value=64  Score=27.93  Aligned_cols=53  Identities=21%  Similarity=0.200  Sum_probs=30.9

Q ss_pred             cCCccEEeccCCCCcccCCCCeeeeccccCCCe--EEEeeccccccCCcccceeeeeccEEEeeeeeeecCCeee
Q 033066            9 LKGRSYYKCRFCNSHLALADSVLSWSFNCRRGR--AYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVG   81 (128)
Q Consensus         9 l~g~~~y~C~~C~thLa~~~~lISk~F~G~~G~--AyLf~~v~Nv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lG   81 (128)
                      |....+|.|..|.           +-|.|+.|.  ||.-..-.|-.+    --.+.|     .++||-.|+..|.
T Consensus        23 ~~~~n~~~CL~cg-----------~~~~g~~~~~ha~~H~~~~~H~~----~v~l~t-----~~~yc~~~~~~v~   77 (440)
T cd02669          23 LSNLNVYACLVCG-----------KYFQGRGKGSHAYTHSLEDNHHV----FLNLET-----LKFYCLPDNYEII   77 (440)
T ss_pred             CCCCcEEEEcccC-----------CeecCCCCCcHHHHHhhccCCCE----EEECCC-----CCEEEeCCCCEEe
Confidence            3445679999998           678777555  544221111111    001112     7899999998765


No 45 
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=20.71  E-value=78  Score=28.39  Aligned_cols=13  Identities=23%  Similarity=0.470  Sum_probs=10.7

Q ss_pred             eeeeEEEEeccCC
Q 033066           79 IVGWKYVAAHDKN   91 (128)
Q Consensus        79 ~lGWkY~~A~e~s   91 (128)
                      .||=||-+++...
T Consensus       271 ~LG~kYS~~lna~  283 (457)
T KOG2324|consen  271 LLGTKYSKPLNAK  283 (457)
T ss_pred             EeccccccccCce
Confidence            6899998888766


No 46 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=20.22  E-value=56  Score=24.57  Aligned_cols=67  Identities=18%  Similarity=0.285  Sum_probs=35.1

Q ss_pred             cEEeccCCCCcccCCCCeee--eccccCCCeE----EEeeccccccCCcccc----eee---eeccEEEeeeeeeecCCe
Q 033066           13 SYYKCRFCNSHLALADSVLS--WSFNCRRGRA----YLFSDVVNIMLGPQEE----RLM---LSGMHTVEDIFCCCCGQI   79 (128)
Q Consensus        13 ~~y~C~~C~thLa~~~~lIS--k~F~G~~G~A----yLf~~v~Nv~~g~~e~----r~m---~TG~H~V~DI~C~~C~~~   79 (128)
                      +.|.|.+|+.+|.++.+-.-  .-|-.....+    .+-=..+|-...+.+.    +.|   +.-+..+++=+|+.|+..
T Consensus        27 ~~~tC~~Cg~~L~lh~~~~~~~pWFEH~~~~~~~~~l~~C~yl~pe~k~~~ri~~L~~~i~~~~pv~~~~~W~Cv~C~~~  106 (128)
T PF11682_consen   27 DHWTCHSCGCPLILHPGTDTEPPWFEHDQHSLAENGLMQCPYLDPEEKERRRIKRLRRMIADLDPVPRKTDWHCVMCGNH  106 (128)
T ss_pred             CeEEEecCCceEEEecCCcCCCCccccCccccChhhcccCceECcccchHHHHHHHHHhccccCCCCcCceEEEecCCCc
Confidence            67999999999998855332  2343322221    1100112222221110    111   233457889999999873


No 47 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=20.21  E-value=32  Score=18.27  Aligned_cols=10  Identities=40%  Similarity=0.959  Sum_probs=5.9

Q ss_pred             eeeeecCCee
Q 033066           71 IFCCCCGQIV   80 (128)
Q Consensus        71 I~C~~C~~~l   80 (128)
                      .+|..|++.|
T Consensus        14 ~fC~~CG~~l   23 (23)
T PF13240_consen   14 KFCPNCGTPL   23 (23)
T ss_pred             cchhhhCCcC
Confidence            4577776643


Done!