Citrus Sinensis ID: 033067


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MATSLMTMPQFSGLRPQISAAPAQSLVAAQPMRRKCSGALGARCGFIGSPTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGSVGHIIGVGVVLGLKNLGAL
ccccccccccccccccccccccccccccccccccccccCEEEEEcccccccCEEEEEHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHccccccc
*************************************GALGARCGFIGSPTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGSVGHIIGVGVVLGLKNLG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSLMTMPQFSGLRPQISAAPAQSLVAAQPMRRKCSGALGARCGFIGSPTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGSVGHIIGVGVVLGLKNLGAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit psaK, chloroplastic confidentQ9SUI5
Photosystem I reaction center subunit psaK, chloroplastic probableQ9ZT05
Photosystem I reaction center subunit psaK, chloroplastic probableP36886

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain K
Confidence level:very confident
Coverage over the Query: 45-128
View the alignment between query and template
View the model in PyMOL