Citrus Sinensis ID: 033068


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEAGEKE
cHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHcccccHHHHHHHHHHHHcccc
***IKETILRYVRVRGFNE*********SRNVLKQLSRQMCA******DEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEAGEKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl carrier protein 3, mitochondrial Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.probableQ9FGJ4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DXE, chain H
Confidence level:very confident
Coverage over the Query: 48-121
View the alignment between query and template
View the model in PyMOL