BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033079
         (128 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 11 LSTSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYV 70
          L  +L   + K++LV LRD  ++ G L SFDQ  N +LE A E +I G++Y     G  V
Sbjct: 12 LGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDA-EEIIDGNVY---KRGTMV 67

Query: 71 IRGENVVLI 79
          +RGENV+ I
Sbjct: 68 VRGENVLFI 76


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 1  MSWAGPDDVYLSTSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDL 60
          MS A P +      L  ++DKKL + L  GR + G L  FD F N V++   E    G  
Sbjct: 1  MSKAHPPE------LKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQ 54

Query: 61 YCDIPLGLYVIRGENVVLIGELD 83
               +G+ VIRG +++++  L+
Sbjct: 55 NN---IGMVVIRGNSIIMLEALE 74


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 15  LASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIV---GDLYCDI-PLGLYV 70
           L+ Y D+++      GR++ G L  FDQ  N VL+   E++     G L   I  LGL V
Sbjct: 32  LSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVV 91

Query: 71  IRGENVVLIGELDLERDELP 90
           +RG  +VLI  +D   +E+P
Sbjct: 92  VRGTTLVLIAPMD-GSEEIP 110


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 15  LASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIV---GDLYCDI-PLGLYV 70
           L+ Y D+++      GR++ G L  FDQ  N VL+   E++     G L   I  LGL V
Sbjct: 28  LSRYQDQRIQATFTGGRQITGILKGFDQLXNLVLDDVEEQLRNPEDGKLTGAIRKLGLVV 87

Query: 71  IRGENVVLIGELD 83
           +RG  +VLI   D
Sbjct: 88  VRGTTLVLIAPXD 100


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 15 LASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRGE 74
          LA  L+  +LV L+  +++ G L S+DQ  N VL  + E  I  D      LG  VIRG+
Sbjct: 14 LAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEE--IQSD-GSGKKLGTIVIRGD 70

Query: 75 NVVLIGEL 82
          NV+LI  L
Sbjct: 71 NVILISPL 78


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 34.3 bits (77), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 12/70 (17%)

Query: 19 LDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIV--------GDLYCDIPLGLYV 70
          LD+++ + LR  R L+GTL +FD   N VL  A E +           +  C+    +  
Sbjct: 19 LDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCE----MVF 74

Query: 71 IRGENVVLIG 80
          IRG+ V LI 
Sbjct: 75 IRGDTVTLIS 84


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 33.9 bits (76), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 14 SLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRG 73
          +L + L+  +++ L+  R+  G L SFD   N VL  A E   + D      LG  +IRG
Sbjct: 17 ALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE---LEDGEVTRRLGTVLIRG 73

Query: 74 ENVVLI 79
          +N+V I
Sbjct: 74 DNIVYI 79


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 33.9 bits (76), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 14 SLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRG 73
          +L + L+  +++ L+  R+  G L SFD   N VL  A E   + D      LG  +IRG
Sbjct: 17 ALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE---LEDGEVTRRLGTVLIRG 73

Query: 74 ENVVLI 79
          +N+V I
Sbjct: 74 DNIVYI 79


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 33.9 bits (76), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 14 SLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRG 73
          +L + L+  +++ L+  R+  G L SFD   N VL  A E   + D      LG  +IRG
Sbjct: 19 ALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE---LEDGEVTRRLGTVLIRG 75

Query: 74 ENVVLI 79
          +N+V I
Sbjct: 76 DNIVYI 81


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 33.9 bits (76), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 14 SLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRG 73
          +L + L+  +++ L+  R+  G L SFD   N VL  A E   + D      LG  +IRG
Sbjct: 17 ALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE---LEDGEVTRRLGTVLIRG 73

Query: 74 ENVVLI 79
          +N+V I
Sbjct: 74 DNIVYI 79


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 33.1 bits (74), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 12 STSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIP------ 65
          S+ +  ++D ++  +L+DGR  +GT  +FD+  N +L    E   +              
Sbjct: 6  SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKR 65

Query: 66 -LGLYVIRGENVV 77
           LGL ++RGEN+V
Sbjct: 66 VLGLVLLRGENLV 78


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 33.1 bits (74), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 12 STSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIP------ 65
          S+ +  ++D ++  +L+DGR  +GT  +FD+  N +L    E   +              
Sbjct: 6  SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKR 65

Query: 66 -LGLYVIRGENVV 77
           LGL ++RGEN+V
Sbjct: 66 VLGLVLLRGENLV 78


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 32.3 bits (72), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 9  VYLSTSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVL 48
          V  S+ +  ++D ++  +L+DGR  +GT  +FD+  N +L
Sbjct: 3  VGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 32.0 bits (71), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%)

Query: 12 STSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVL 48
          S+ +  ++D ++  +L+DGR  +GT  +FD+  N +L
Sbjct: 6  SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 30.8 bits (68), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 15 LASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDIPLGLYVIRGE 74
          L   L   ++V L+ GR+  GTL  +D   N VL  A E +  G++   +  G  VIRG+
Sbjct: 9  LNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDA-EEIQNGEVVRKV--GSVVIRGD 65

Query: 75 NVVLI 79
           VV +
Sbjct: 66 TVVFV 70


>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
 pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
 pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
 pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
 pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
 pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
 pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
 pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
 pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
 pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
 pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
 pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
 pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
 pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
          Length = 93

 Score = 29.3 bits (64), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 19 LDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERV-IVGDLYCDIPLGLYVI------ 71
          LD+ + V LR  R+L G L ++D+  N VL  A E V I  D   D    L  I      
Sbjct: 18 LDEIVYVKLRGDRELNGRLHAYDEHLNXVLGDAEEIVTIFDDEETDKDKALKTIRKHYEX 77

Query: 72 ---RGENVVLIG 80
             RG++V+LI 
Sbjct: 78 LFVRGDSVILIA 89


>pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human
          Snrnp Core Domain
 pdb|3CW1|C Chain C, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|P Chain P, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Q Chain Q, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|R Chain R, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|Y Chain Y, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|V Chain V, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|B Chain B, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|B Chain B, Macromolecular Machine 6
 pdb|4F7U|D Chain D, Macromolecular Machine 6
 pdb|1VU2|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|XX Chain x, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|4F77|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|4F77|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|4F77|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|4F77|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|4F77|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|4F77|XX Chain x, The 8s Snrnp Assembly Intermediate
          Length = 118

 Score = 29.3 bits (64), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 4  AGPDDVYLSTSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACE 53
           GP  V L+ S+ +  + ++L+  R+ +KL+G + +FD+  N VLE   E
Sbjct: 26 TGPLSV-LTQSVKN--NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 72


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 28.5 bits (62), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 19 LDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACE 53
          +   L V+++  R+  GTL  FD + N VL+   E
Sbjct: 17 IGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTE 51


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 27.7 bits (60), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 19 LDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACE 53
          +   L V+ +  R+  GTL  FD + N VL+   E
Sbjct: 29 IGSNLWVIXKSEREFAGTLVGFDDYVNIVLKDVTE 63


>pdb|1RKI|A Chain A, Structure Of Pag5_736 From P. Aerophilum With Three
          Disulphide Bonds
 pdb|1RKI|B Chain B, Structure Of Pag5_736 From P. Aerophilum With Three
          Disulphide Bonds
          Length = 102

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 10/71 (14%)

Query: 5  GPDDVYLSTSLASYLDKKLLVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGDLYCDI 64
          GP  VY+STSL + L+K L   L   +KL+  +  FD+  N+  +  C++ ++ ++    
Sbjct: 38 GPSKVYVSTSLEN-LEKCL--QLHYFKKLVKNIEIFDEVHNS--KPNCDKCLIVEI---- 88

Query: 65 PLGLYVIRGEN 75
            G+Y +R  N
Sbjct: 89 -GGVYFVRRVN 98


>pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase
           Reductase Module At 2.3 A Resolution.
 pdb|1TLL|B Chain B, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase
           Reductase Module At 2.3 A Resolution
          Length = 688

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 24  LVLLRDGRKLMGTLCSFDQFANAVLEGACERVIVGD 59
           ++ +R+G +L G   +F  +A  V + AC+   VGD
Sbjct: 170 ILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGD 205


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.140    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,699,315
Number of Sequences: 62578
Number of extensions: 137085
Number of successful extensions: 327
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 306
Number of HSP's gapped (non-prelim): 25
length of query: 128
length of database: 14,973,337
effective HSP length: 87
effective length of query: 41
effective length of database: 9,529,051
effective search space: 390691091
effective search space used: 390691091
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)