Query         033081
Match_columns 128
No_of_seqs    37 out of 39
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 09:35:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033081.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033081hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13991 BssS:  BssS protein fa  87.0    0.75 1.6E-05   32.5   3.0   43   40-93      2-55  (73)
  2 PRK12301 bssS biofilm formatio  57.8     9.1  0.0002   28.0   2.2   45   39-94     11-66  (84)
  3 KOG3389 NADH:ubiquinone oxidor  50.0     7.9 0.00017   31.5   0.9   16   36-51    107-122 (178)
  4 cd08915 V_Alix_like Protein-in  48.1      22 0.00048   29.1   3.3   32   79-110    10-41  (342)
  5 KOG1610 Corticosteroid 11-beta  41.9      10 0.00022   33.2   0.4   19   74-93     56-74  (322)
  6 PF04800 ETC_C1_NDUFA4:  ETC co  41.1      12 0.00026   27.4   0.7   19   35-53     31-49  (101)
  7 KOG1268 Glucosamine 6-phosphat  37.2      18 0.00038   34.5   1.2   21   99-119   363-397 (670)
  8 cd09237 V_ScBro1_like Protein-  36.6      44 0.00096   27.8   3.4   30   79-109    10-39  (356)
  9 KOG4108 Dynein light chain [Ce  35.4   2E+02  0.0044   23.3   6.8   39   80-119    71-109 (174)
 10 PF10925 DUF2680:  Protein of u  35.3      47   0.001   22.1   2.7   23   77-99     30-52  (59)
 11 PRK15441 peptidyl-prolyl cis-t  34.8      32 0.00069   23.3   1.9   23   79-101    12-34  (93)
 12 cd00483 HPPK 7,8-dihydro-6-hyd  34.6      16 0.00035   26.7   0.5   24   33-56     34-57  (128)
 13 PF00771 FHIPEP:  FHIPEP family  33.6      14  0.0003   34.3   0.0   29   75-103   139-167 (658)
 14 PLN03052 acetate--CoA ligase;   33.5      38 0.00082   30.6   2.7   11   97-107    63-73  (728)
 15 PRK13658 hypothetical protein;  33.4      20 0.00043   24.8   0.7   13   96-108    14-30  (59)
 16 PRK10239 2-amino-4-hydroxy-6-h  31.9      23 0.00049   27.4   0.9   23   33-55     37-59  (159)
 17 PF01756 ACOX:  Acyl-CoA oxidas  30.2      30 0.00066   25.9   1.3   32   78-109   104-149 (187)
 18 PRK15337 type III secretion sy  29.6      36 0.00077   32.4   1.9   26   77-102   161-186 (686)
 19 PF12513 SUV3_C:  Mitochondrial  28.1      42  0.0009   20.9   1.5   20   74-94     20-40  (49)
 20 PF15361 RIC3:  Resistance to i  28.0      44 0.00095   25.7   1.9   20   78-97    126-145 (152)
 21 TIGR01398 FlhA flagellar biosy  26.7      43 0.00094   31.8   2.0   26   77-102   155-180 (678)
 22 TIGR01498 folK 2-amino-4-hydro  25.8      31 0.00068   25.4   0.7   24   32-55     32-55  (127)
 23 TIGR01399 hrcV type III secret  25.6      46   0.001   31.6   1.9   26   77-102   151-176 (677)
 24 KOG3894 SNARE protein Syntaxin  25.5      60  0.0013   28.5   2.5   25   79-103   226-252 (316)
 25 PF02217 T_Ag_DNA_bind:  Origin  25.5      46   0.001   24.6   1.6   16   79-94     27-42  (94)
 26 PHA02417 hypothetical protein   24.9      57  0.0012   23.8   1.9   15  100-114    51-66  (83)
 27 PRK06012 flhA flagellar biosyn  24.5      51  0.0011   31.1   2.0   26   77-102   172-197 (697)
 28 PRK05910 type III secretion sy  24.0      53  0.0011   30.8   2.0   26   77-102   156-181 (584)
 29 PF12209 SAC3:  Leucine permeas  23.6      95  0.0021   21.6   2.8   36   75-110    21-63  (79)
 30 cd00307 RuBisCO_small_like Rib  23.4      32  0.0007   24.4   0.4   11   36-46     31-41  (84)
 31 PF10231 DUF2315:  Uncharacteri  23.3 1.3E+02  0.0029   22.8   3.7   45   48-103     2-47  (126)
 32 PF08153 NGP1NT:  NGP1NT (NUC09  22.5      12 0.00027   28.8  -2.0   30   73-102    71-100 (130)
 33 PRK12792 flhA flagellar biosyn  22.1      61  0.0013   30.9   2.0   26   77-102   169-194 (694)
 34 PRK09767 hypothetical protein;  21.5      45 0.00097   24.6   0.8   16   82-97      6-21  (117)
 35 COG4003 Uncharacterized protei  21.4      75  0.0016   23.8   2.0   17   78-94     61-77  (98)
 36 cd09236 V_AnPalA_UmRIM20_like   21.1 1.1E+02  0.0025   25.6   3.3   32   79-110    10-41  (353)

No 1  
>PF13991 BssS:  BssS protein family
Probab=86.99  E-value=0.75  Score=32.48  Aligned_cols=43  Identities=30%  Similarity=0.516  Sum_probs=29.5

Q ss_pred             cccCCCCC-----------CcccCCCCCCCCCchhhHhhhcCCCCCcCCCcccHHHHHHHHHHhh
Q 033081           40 PLFGWSSE-----------ADYIDSESKPENRSESDLEAKSSRSSRFSPGCFTEEKAKQLRLMTK   93 (128)
Q Consensus        40 PLfGWS~~-----------~DYi~~~~~~~~~~e~e~~~~~~r~srF~~G~lTEEKAkqLR~~~~   93 (128)
                      |+.||--.           .+|++........      +.  . .+|.  +||.|-||||...+.
T Consensus         2 Pv~GW~i~pv~~~dal~lrl~yls~~~q~~e~------a~--~-~~~~--~lT~e~Ar~Li~~L~   55 (73)
T PF13991_consen    2 PVTGWDIGPVDSYDALMLRLHYLSSPDQPPEE------AQ--V-GRTY--WLTTEMARQLISILE   55 (73)
T ss_pred             CcccceeccccccceeEEEecccCCCCCCccc------cc--c-Ccee--EecHHHHHHHHHHHH
Confidence            88899544           3888886655322      11  2 3565  799999999998764


No 2  
>PRK12301 bssS biofilm formation regulatory protein BssS; Reviewed
Probab=57.75  E-value=9.1  Score=28.01  Aligned_cols=45  Identities=18%  Similarity=0.364  Sum_probs=27.9

Q ss_pred             ccccCCCCCC-----------cccCCCCCCCCCchhhHhhhcCCCCCcCCCcccHHHHHHHHHHhhh
Q 033081           39 SPLFGWSSEA-----------DYIDSESKPENRSESDLEAKSSRSSRFSPGCFTEEKAKQLRLMTKD   94 (128)
Q Consensus        39 aPLfGWS~~~-----------DYi~~~~~~~~~~e~e~~~~~~r~srF~~G~lTEEKAkqLR~~~~e   94 (128)
                      -|+.||--.+           +|+..+..++..       +..  -||.  .||.+-||||=..+-+
T Consensus        11 hPvvGWdistvd~YDAmmirlhyLss~~Q~~e~-------A~v--~~tl--wLTtdvArqlI~iLea   66 (84)
T PRK12301         11 HPLVGWDISTVDSYDALMLRLHYQSPNDQEPEG-------AEV--GQTL--WLTTDVARQFISILEA   66 (84)
T ss_pred             cccccccccCcccHhhHHHhhhhcCCCCCCccc-------ccc--cceE--EecHHHHHHHHHHHHH
Confidence            3899997653           466554433222       111  2465  6999999999776643


No 3  
>KOG3389 consensus NADH:ubiquinone oxidoreductase, NDUFS4/18 kDa subunit [Energy production and conversion]
Probab=49.95  E-value=7.9  Score=31.45  Aligned_cols=16  Identities=50%  Similarity=1.155  Sum_probs=13.7

Q ss_pred             CccccccCCCCCCccc
Q 033081           36 NWWSPLFGWSSEADYI   51 (128)
Q Consensus        36 ~WWaPLfGWS~~~DYi   51 (128)
                      +|=.||.||++.+|=+
T Consensus       107 rWENPLMGWtsTaDPl  122 (178)
T KOG3389|consen  107 RWENPLMGWTSTADPL  122 (178)
T ss_pred             hccCccccccccCCcc
Confidence            6889999999998744


No 4  
>cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains. This superfamily contains the V-shaped (V) domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, and related domains. Alix, HD-PTP, Bro1, and Rim20 all interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), participates in membrane remodeling processes during the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), and the abscission reactions of mammalian cell division. It also functions in apoptosis. HD-PTP functions in cell migration and endosomal trafficking, Bro1 in endosomal trafficking, and Rim20 in the response to the external pH via the Rim101 pathway. The Alix V-domain contains 
Probab=48.06  E-value=22  Score=29.13  Aligned_cols=32  Identities=16%  Similarity=0.252  Sum_probs=27.3

Q ss_pred             cccHHHHHHHHHHhhhhhhhHHHHHHHHHHHH
Q 033081           79 CFTEEKAKQLRLMTKDTASFHDAMYHSAIASR  110 (128)
Q Consensus        79 ~lTEEKAkqLR~~~~etesFHD~MYHSAIASR  110 (128)
                      .++|+||+.+|..+++----++.++++.++|.
T Consensus        10 ~Y~E~k~~lvr~e~~~~~e~~~~~l~~~L~sl   41 (342)
T cd08915          10 AYNERQDDYVREHIVEPIEALNKLLNSFLAER   41 (342)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
Confidence            36899999999998566677899999999885


No 5  
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only]
Probab=41.90  E-value=10  Score=33.16  Aligned_cols=19  Identities=58%  Similarity=0.817  Sum_probs=16.6

Q ss_pred             CcCCCcccHHHHHHHHHHhh
Q 033081           74 RFSPGCFTEEKAKQLRLMTK   93 (128)
Q Consensus        74 rF~~G~lTEEKAkqLR~~~~   93 (128)
                      -|. ||||||.|++||..+.
T Consensus        56 V~A-gcl~~~gae~L~~~~~   74 (322)
T KOG1610|consen   56 VFA-GCLTEEGAESLRGETK   74 (322)
T ss_pred             EEE-EeecCchHHHHhhhhc
Confidence            354 9999999999999985


No 6  
>PF04800 ETC_C1_NDUFA4:  ETC complex I subunit conserved region;  InterPro: IPR006885 This entry represents prokaryotic NADH-ubiquinone oxidoreductase subunits (1.6.5.3 from EC, 1.6.99.3 from EC) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein [].; GO: 0016651 oxidoreductase activity, acting on NADH or NADPH, 0022900 electron transport chain, 0005743 mitochondrial inner membrane; PDB: 2JYA_A 2LJU_A.
Probab=41.13  E-value=12  Score=27.38  Aligned_cols=19  Identities=37%  Similarity=0.977  Sum_probs=11.0

Q ss_pred             CCccccccCCCCCCcccCC
Q 033081           35 SNWWSPLFGWSSEADYIDS   53 (128)
Q Consensus        35 ~~WWaPLfGWS~~~DYi~~   53 (128)
                      .+|=-||.||.+..|.+.-
T Consensus        31 ~~~~~PLMGWtss~D~~~q   49 (101)
T PF04800_consen   31 ARWENPLMGWTSSGDPLSQ   49 (101)
T ss_dssp             SS---TTT-SSSS--SEEE
T ss_pred             CCcCCCccCCCCCCChhhC
Confidence            3788999999999998874


No 7  
>KOG1268 consensus Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains [Cell wall/membrane/envelope biogenesis]
Probab=37.20  E-value=18  Score=34.50  Aligned_cols=21  Identities=57%  Similarity=0.759  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHH--------------Hhhhhcccc
Q 033081           99 HDAMYHSAIASR--------------LASDFKIRS  119 (128)
Q Consensus        99 HD~MYHSAIASR--------------LAsd~~~r~  119 (128)
                      +-+-||||+|.|              |||||-.|.
T Consensus       363 cgtSyhs~~A~R~ilEEL~eiPV~vElAsDflDR~  397 (670)
T KOG1268|consen  363 CGTSYHSALATRPILEELSEIPVSVELASDFLDRN  397 (670)
T ss_pred             ecchHHHHHHHHHHHHHHhcCCeeeehhhhhHhcC
Confidence            455699999999              788886653


No 8  
>cd09237 V_ScBro1_like Protein-interacting V-domain of Saccharomyces cerevisiae Bro1 and related domains. This family contains the V-shaped (V) domain of Saccharomyces cerevisiae Bro1, and related domains. It belongs to the V_Alix_like superfamily which also includes the V-domain of Saccharomyces cerevisiae Rim20 (also known as PalA), mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), and related domains. Bro1 interacts with the ESCRT (Endosomal Sorting Complexes Required for Transport) system, and participates in endosomal trafficking. The mammalian Alix V-domain (belonging to a different family) contains a binding site, partially conserved in the superfamily, for the retroviral late assembly (L) domain YPXnL motif. The Alix V-domain is also a dimerization domain. Bro1 also has an N-terminal Bro1-like domain, which binds Snf7, a component of the ESCRT-III complex, and a C-terminal proline-rich
Probab=36.55  E-value=44  Score=27.84  Aligned_cols=30  Identities=30%  Similarity=0.374  Sum_probs=24.2

Q ss_pred             cccHHHHHHHHHHhhhhhhhHHHHHHHHHHH
Q 033081           79 CFTEEKAKQLRLMTKDTASFHDAMYHSAIAS  109 (128)
Q Consensus        79 ~lTEEKAkqLR~~~~etesFHD~MYHSAIAS  109 (128)
                      ..+||||+.+|..+.+ --.++..+|+.+++
T Consensus        10 ~YsE~ka~lvr~e~~~-~e~a~~~~~~~L~~   39 (356)
T cd09237          10 LYSEEKAKLLRAEVER-VEVANEEYASFLEY   39 (356)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH
Confidence            3689999999999644 45678888988876


No 9  
>KOG4108 consensus Dynein light chain [Cell motility]
Probab=35.37  E-value=2e+02  Score=23.29  Aligned_cols=39  Identities=21%  Similarity=0.277  Sum_probs=26.9

Q ss_pred             ccHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhhhhcccc
Q 033081           80 FTEEKAKQLRLMTKDTASFHDAMYHSAIASRLASDFKIRS  119 (128)
Q Consensus        80 lTEEKAkqLR~~~~etesFHD~MYHSAIASRLAsd~~~r~  119 (128)
                      |..+-++..=+..+ +|..||.+||+--|.+|+..+....
T Consensus        71 F~~~~v~~iI~~vl-~e~L~~~~Y~~~~a~~lt~elae~I  109 (174)
T KOG4108|consen   71 FPAERVEKIIEAVL-TEKLADAEYDPDEALQLTKELAEEI  109 (174)
T ss_pred             CCHHHHHHHHHHHH-HHHhhhhccCHHHHHHHHHHHHHHH
Confidence            33444443333333 6888999999999999999776543


No 10 
>PF10925 DUF2680:  Protein of unknown function (DUF2680);  InterPro: IPR024485 Members in this family of proteins are annotated as YckD however currently no function is known.
Probab=35.26  E-value=47  Score=22.09  Aligned_cols=23  Identities=17%  Similarity=0.384  Sum_probs=18.7

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFH   99 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFH   99 (128)
                      .|.+|.|+|..+...|-+-..++
T Consensus        30 ~G~iTqeqAd~ik~~id~~~~~~   52 (59)
T PF10925_consen   30 AGVITQEQADAIKKHIDQRQEYM   52 (59)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHHH
Confidence            38999999999999987655554


No 11 
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional
Probab=34.81  E-value=32  Score=23.25  Aligned_cols=23  Identities=26%  Similarity=0.147  Sum_probs=19.5

Q ss_pred             cccHHHHHHHHHHhhhhhhhHHH
Q 033081           79 CFTEEKAKQLRLMTKDTASFHDA  101 (128)
Q Consensus        79 ~lTEEKAkqLR~~~~etesFHD~  101 (128)
                      +-+|++|++|+.++.+.++|=++
T Consensus        12 ~~~~~~A~~i~~~l~~g~~F~~l   34 (93)
T PRK15441         12 VKEEKLALDLLEQIKNGADFGKL   34 (93)
T ss_pred             ECCHHHHHHHHHHHHCCCCHHHH
Confidence            45899999999999988998653


No 12 
>cd00483 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after uptake by a carrier-mediated active transport system. Most microbes and plants lack this system and must synthesize folates de novo from guanosine triphosphate.  One enzyme from this pathway is HPPK which catalyzes pyrophosphoryl transfer from ATP to 6-hydroxymethyl-7,8-dihydropterin (HP). The functional enzyme is a monomer.  Mammals lack many of the enzymes in the folate pathway including, HPPK.
Probab=34.59  E-value=16  Score=26.66  Aligned_cols=24  Identities=13%  Similarity=0.383  Sum_probs=20.4

Q ss_pred             CCCCccccccCCCCCCcccCCCCC
Q 033081           33 ASSNWWSPLFGWSSEADYIDSESK   56 (128)
Q Consensus        33 ~~~~WWaPLfGWS~~~DYi~~~~~   56 (128)
                      .|.-||+|-+|..+++||+|+-..
T Consensus        34 ~S~~y~T~p~g~~~~~~FlN~v~~   57 (128)
T cd00483          34 VSPLYETAPVGFTDQPDFLNAVVE   57 (128)
T ss_pred             ECCCEEeCCCCCCCChHHHheEEE
Confidence            466899999999999999998543


No 13 
>PF00771 FHIPEP:  FHIPEP family;  InterPro: IPR001712 The Flagellar/Hr/Invasion Proteins Export Pore (FHIPEP) family [, ] consists of a number of proteins that constitute the type III secretion (or signal peptide-independent) pathway apparatus [, ]. This mechanism translocates proteins lacking an N-terminal signal peptide across the cell membrane in one step, as it does not require an intermediate periplasmic process to cleave the signal peptide. It is a common pathway amongst Gram-negative bacteria for secreting toxic and flagellar proteins. The pathway apparatus comprises three components: two within the inner membrane and one within the outer []. An FHIPEP protein is located within the inner membrane, although it is unknown which component it constitutes. FHIPEP proteins have all about 700 amino-acid residues. Within the sequence, the N terminus is highly conserved and hydrophobic, suggesting that this terminus is embedded within the membrane, with 6-8 transmembrane (TM) domains, while the C terminus is less conserved and appears to be devoid of TM regions. It is possible that members of the FHIPEP family serve as pores for the export of specific proteins.; GO: 0009306 protein secretion, 0016020 membrane; PDB: 3MIX_A 2X4A_A 3LW9_A 2X49_A 3MYD_A 3A5I_A.
Probab=33.55  E-value=14  Score=34.34  Aligned_cols=29  Identities=31%  Similarity=0.383  Sum_probs=0.0

Q ss_pred             cCCCcccHHHHHHHHHHhhhhhhhHHHHH
Q 033081           75 FSPGCFTEEKAKQLRLMTKDTASFHDAMY  103 (128)
Q Consensus        75 F~~G~lTEEKAkqLR~~~~etesFHD~MY  103 (128)
                      +-.|..|||.||..|+++..-+.|+-+|=
T Consensus       139 l~aG~I~~~eA~~rR~~l~~E~~fyGaMD  167 (658)
T PF00771_consen  139 LNAGLIDEEEARRRREELEREADFYGAMD  167 (658)
T ss_dssp             -----------------------------
T ss_pred             hhcCCCCHHHHHHHHHHHHHHhhhhhhcc
Confidence            34589999999999999998899999983


No 14 
>PLN03052 acetate--CoA ligase; Provisional
Probab=33.54  E-value=38  Score=30.59  Aligned_cols=11  Identities=36%  Similarity=0.627  Sum_probs=9.2

Q ss_pred             hhHHHHHHHHH
Q 033081           97 SFHDAMYHSAI  107 (128)
Q Consensus        97 sFHD~MYHSAI  107 (128)
                      +||++||||--
T Consensus        63 ~~~~~~~~~~~   73 (728)
T PLN03052         63 ALHQLMYYSCY   73 (728)
T ss_pred             cHHHHhhhhcc
Confidence            69999999853


No 15 
>PRK13658 hypothetical protein; Provisional
Probab=33.37  E-value=20  Score=24.80  Aligned_cols=13  Identities=46%  Similarity=0.710  Sum_probs=9.4

Q ss_pred             hhhHHHH----HHHHHH
Q 033081           96 ASFHDAM----YHSAIA  108 (128)
Q Consensus        96 esFHD~M----YHSAIA  108 (128)
                      .+.-|++    |||||-
T Consensus        14 DTVLDILVAGdyHSAI~   30 (59)
T PRK13658         14 DTVLDILVAGDYHSAIH   30 (59)
T ss_pred             hHHHHHHhcccHHHHHH
Confidence            4556765    999994


No 16 
>PRK10239 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase; Provisional
Probab=31.92  E-value=23  Score=27.37  Aligned_cols=23  Identities=26%  Similarity=0.502  Sum_probs=20.2

Q ss_pred             CCCCccccccCCCCCCcccCCCC
Q 033081           33 ASSNWWSPLFGWSSEADYIDSES   55 (128)
Q Consensus        33 ~~~~WWaPLfGWS~~~DYi~~~~   55 (128)
                      .|.-|+++-+|..+++||+|+-.
T Consensus        37 ~S~~y~T~P~g~~~q~~FlN~v~   59 (159)
T PRK10239         37 VSSFYRTPPLGPQDQPDYLNAAV   59 (159)
T ss_pred             ECCCEEeCCCCCCCCCCceEEEE
Confidence            46789999999999999999854


No 17 
>PF01756 ACOX:  Acyl-CoA oxidase;  InterPro: IPR002655 Acyl-CoA oxidase (ACO) acts on CoA derivatives of fatty acids with chain lengths from 8 to 18. It catalyses the first and rate-determining step of the peroxisomal beta-oxidation of fatty acids []. Acyl-CoA oxidase is a homodimer and the polypeptide chain of the subunit is folded into the N-terminal alpha-domain, beta-domain, and C-terminal alpha-domain []. Functional differences between the peroxisomal acyl-CoA oxidases and the mitochondrial acyl-CoA dehydrogenases are attributed to structural differences in the FAD environments [].  Experimental data indicate that, in the pumpkin, the expression pattern of ACOX is very similar to that of the glyoxysomal enzyme 3-ketoacyl-CoA thiolase []. In humans, defects in ACOX1 are the cause of pseudoneonatal adrenoleukodystrophy, also known as peroxisomal acyl-CoA oxidase deficiency. Pseudo-NALD is a peroxisomal single-enzyme disorder. Clinical features include mental retardation, leukodystrophy, seizures, mild hepatomegaly and hearing deficit. Pseudo-NALD is characterised by increased plasma levels of very-long chain fatty acids due to a decrease in, or absence of, peroxisome acyl-CoA oxidase activity, despite the peroxisomes being intact and functioning. This entry represents the Acyl-CoA oxidase C-terminal.; GO: 0003997 acyl-CoA oxidase activity, 0006635 fatty acid beta-oxidation, 0055114 oxidation-reduction process, 0005777 peroxisome; PDB: 2FON_A 1IS2_B 2DDH_A 1W07_B.
Probab=30.21  E-value=30  Score=25.90  Aligned_cols=32  Identities=31%  Similarity=0.432  Sum_probs=21.8

Q ss_pred             CcccHHHHHHHHHHh--------------hhhhhhHHHHHHHHHHH
Q 033081           78 GCFTEEKAKQLRLMT--------------KDTASFHDAMYHSAIAS  109 (128)
Q Consensus        78 G~lTEEKAkqLR~~~--------------~etesFHD~MYHSAIAS  109 (128)
                      |.+|.++++.||...              +++=-|+|.+.+|+|++
T Consensus       104 g~ls~~~~~~l~~~i~~l~~~lrp~av~LVDAF~~~D~~L~S~iG~  149 (187)
T PF01756_consen  104 GYLSPEQIKALRKAIEELCAELRPNAVALVDAFDFPDFFLNSPIGR  149 (187)
T ss_dssp             TSS-HHHHHHHHHHHHHHHHHHGGGHHHHHHTT---HHHHT-STT-
T ss_pred             CcCCHHHHHHHHHHHHHHHHHHHhHHHHHHHhcCCCHHHHcChhcc
Confidence            789999999999864              55667899999999975


No 18 
>PRK15337 type III secretion system protein InvA; Provisional
Probab=29.58  E-value=36  Score=32.38  Aligned_cols=26  Identities=12%  Similarity=0.243  Sum_probs=23.9

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||+-|+++.+-+.|+-+|
T Consensus       161 AG~Ide~eAr~RR~~l~~EadFyGAM  186 (686)
T PRK15337        161 AGIIDADGVKERRSVLERESQLYGSF  186 (686)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHhccCc
Confidence            48999999999999999888999887


No 19 
>PF12513 SUV3_C:  Mitochondrial degradasome RNA helicase subunit C terminal;  InterPro: IPR022192  This domain family is found in bacteria and eukaryotes, and is approximately 50 amino acids in length. The family is found in association with PF00271 from PFAM. The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 3RC8_A 3RC3_A.
Probab=28.06  E-value=42  Score=20.87  Aligned_cols=20  Identities=35%  Similarity=0.713  Sum_probs=15.0

Q ss_pred             CcCCCcccH-HHHHHHHHHhhh
Q 033081           74 RFSPGCFTE-EKAKQLRLMTKD   94 (128)
Q Consensus        74 rF~~G~lTE-EKAkqLR~~~~e   94 (128)
                      || |+.|++ |+|.++|..+.+
T Consensus        20 Rf-p~~F~d~e~a~~~k~~~~~   40 (49)
T PF12513_consen   20 RF-PDVFPDRELAEELKKRVEE   40 (49)
T ss_dssp             C--TTTSTTHHHHHHHHHHHHH
T ss_pred             Hc-ccccCCHHHHHHHHHHHHH
Confidence            67 567776 999999998754


No 20 
>PF15361 RIC3:  Resistance to inhibitors of cholinesterase homologue 3
Probab=27.96  E-value=44  Score=25.69  Aligned_cols=20  Identities=20%  Similarity=0.077  Sum_probs=18.2

Q ss_pred             CcccHHHHHHHHHHhhhhhh
Q 033081           78 GCFTEEKAKQLRLMTKDTAS   97 (128)
Q Consensus        78 G~lTEEKAkqLR~~~~etes   97 (128)
                      ..+|+.+-.||+.|+.|||.
T Consensus       126 ~~~~~~eL~qLq~rL~qTE~  145 (152)
T PF15361_consen  126 RKITDYELAQLQERLAQTER  145 (152)
T ss_pred             ccchHHHHHHHHHHHHHHHH
Confidence            46899999999999999995


No 21 
>TIGR01398 FlhA flagellar biosynthesis protein FlhA. This model describes flagellar biosynthesis protein FlhA, one of a large number of genes associated with the biosynthesis of functional bacterial flagella. Homologs of many such proteins, including FlhA, function in type III protein secretion systems. A separate model describes InvA (Salmonella enterica), LcrD (Yersinia enterocolitica), HrcV (Xanthomonas), etc., all of which score below the noise cutoff for this model.
Probab=26.75  E-value=43  Score=31.76  Aligned_cols=26  Identities=42%  Similarity=0.479  Sum_probs=23.9

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||+-|+++.+-+.|+-+|
T Consensus       155 AG~I~~~eAr~RR~~l~~Ea~FyGAM  180 (678)
T TIGR01398       155 AGLITEEEAKKRREELEQEADFYGAM  180 (678)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHhcccc
Confidence            48999999999999999888999887


No 22 
>TIGR01498 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase. This model describes the folate biosynthesis enzyme 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase. Alternate names include 6-hydroxymethyl-7,8-dihydropterin diphosphokinase and 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (HPPK). The extreme C-terminal region, of typically eight to thirty residues, is not included in the model. This enzyme may be found as a fusion protein with other enzymes of folate biosynthesis.
Probab=25.83  E-value=31  Score=25.39  Aligned_cols=24  Identities=21%  Similarity=0.505  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCCCCCcccCCCC
Q 033081           32 NASSNWWSPLFGWSSEADYIDSES   55 (128)
Q Consensus        32 ~~~~~WWaPLfGWS~~~DYi~~~~   55 (128)
                      ..|.-+++|-+|...+|||+|+..
T Consensus        32 ~~S~~y~T~p~g~~~q~~FlN~v~   55 (127)
T TIGR01498        32 IVSSIYETPPWGFTDQPDFLNAVV   55 (127)
T ss_pred             EEccCEEEcCCCCCCCchhheEEE
Confidence            346789999999999999999754


No 23 
>TIGR01399 hrcV type III secretion protein, HrcV family. Members of this family are closely homologous to the flagellar biosynthesis protein FlhA (TIGR01398) and should all participate in type III secretion systems. Examples include InvA (Salmonella enterica), LcrD (Yersinia enterocolitica), HrcV (Xanthomonas), etc. Type III secretion systems resemble flagellar biogenesis systems, and may share the property of translocating special classes of peptides through the membrane.
Probab=25.61  E-value=46  Score=31.58  Aligned_cols=26  Identities=19%  Similarity=0.340  Sum_probs=23.8

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||+-|+++.+-+.|+-+|
T Consensus       151 AGlI~~~eAr~RR~~l~~Ea~FyGAM  176 (677)
T TIGR01399       151 AGVIDADEARRRRSTLEKESQLYGAM  176 (677)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHhccCc
Confidence            48999999999999999888998877


No 24 
>KOG3894 consensus SNARE protein Syntaxin 18/UFE1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.55  E-value=60  Score=28.50  Aligned_cols=25  Identities=8%  Similarity=0.183  Sum_probs=21.9

Q ss_pred             ccc--HHHHHHHHHHhhhhhhhHHHHH
Q 033081           79 CFT--EEKAKQLRLMTKDTASFHDAMY  103 (128)
Q Consensus        79 ~lT--EEKAkqLR~~~~etesFHD~MY  103 (128)
                      .+.  -++++|++++++|-+..||+|-
T Consensus       226 ~~n~~~devrqie~~lvEI~~Lq~ifs  252 (316)
T KOG3894|consen  226 ELNELLDEVRQIEKRLVEISALQDIFS  252 (316)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455  5889999999999999999984


No 25 
>PF02217 T_Ag_DNA_bind:  Origin of replication binding protein;  InterPro: IPR003133 The group of polyomaviruses is formed by the homonymous murine virus (Py) as well as other representative members such as the simian virus 40 (SV40) and the human BK and JC viruses []. Their large T antigen (T-ag) protein binds to and activates DNA replication from the origin of DNA replication (ori). Insofar as is known, the T-ag binds to the origin first as a monomer to its pentanucleotide recognition element. The monomers are then thought to assemble into hexamers and double hexamers, which constitute the form that is active in initiation of DNA replication. When bound to the ori, T-ag double hexamers encircle DNA []. T-ag is a multidomain protein that contains an N-terminal J domain, which mediates protein interactions (see PDOC00553 from PROSITEDOC, IPR001623 from INTERPRO), a central origin-binding domain (OBD), and a C-terminal superfamily 3 helicase domain (see PDOC51206 from PROSITEDOC, IPR010932 from INTERPRO) []. This entry represents the central origin-binding domain (OBD). The overall fold of the ~130-residue T-ag OBD can be described as a central five-stranded antiparallel beta-sheet flanked by two alpha-helices on one side and one alpha-helix and one 3(10)-helix on the other. Both faces of the central beta-sheet are largely hydrophobic and are protected from solvent by the helices, thus forming two hydrophobic cores []. The T-ag OBD molecules are arranged as a spiral with a left-handed twist having six T-ag OBD's per turn. The spiral surrounds a central channel, the inner wall of which consists of alpha helices []. ; GO: 0003688 DNA replication origin binding, 0006260 DNA replication; PDB: 2IPR_B 2ITL_B 1Z1D_B 2FUF_A 2TBD_A 3QK2_A 2ITJ_A 2IF9_A 2NL8_A 2NTC_A ....
Probab=25.50  E-value=46  Score=24.57  Aligned_cols=16  Identities=38%  Similarity=0.254  Sum_probs=13.5

Q ss_pred             cccHHHHHHHHHHhhh
Q 033081           79 CFTEEKAKQLRLMTKD   94 (128)
Q Consensus        79 ~lTEEKAkqLR~~~~e   94 (128)
                      .=|-||+++|+.++.|
T Consensus        27 yTT~eK~~~Ly~kl~~   42 (94)
T PF02217_consen   27 YTTKEKAEQLYKKLLE   42 (94)
T ss_dssp             EEEHHHHHHHHHHCHH
T ss_pred             EEcHHHHHHHHHHHHH
Confidence            4589999999999864


No 26 
>PHA02417 hypothetical protein
Probab=24.88  E-value=57  Score=23.78  Aligned_cols=15  Identities=40%  Similarity=0.328  Sum_probs=11.9

Q ss_pred             HHHHHHH-HHHHHhhh
Q 033081          100 DAMYHSA-IASRLASD  114 (128)
Q Consensus       100 D~MYHSA-IASRLAsd  114 (128)
                      .+|.|+| ||.||||-
T Consensus        51 s~~l~aAv~ARR~A~L   66 (83)
T PHA02417         51 EAAIRAAVIARRRARL   66 (83)
T ss_pred             HHHHHHHHHHHHHhcc
Confidence            4688886 79999983


No 27 
>PRK06012 flhA flagellar biosynthesis protein FlhA; Validated
Probab=24.52  E-value=51  Score=31.14  Aligned_cols=26  Identities=38%  Similarity=0.460  Sum_probs=23.8

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||.-|+++.+-+.|+-+|
T Consensus       172 aG~I~~~eAr~rR~~l~~Es~fyGaM  197 (697)
T PRK06012        172 AGLIDEEEAKKRRKELQQEADFYGAM  197 (697)
T ss_pred             cCCCCHHHHHHHHHHHHHHHhhcccc
Confidence            48999999999999999888998887


No 28 
>PRK05910 type III secretion system protein; Validated
Probab=23.97  E-value=53  Score=30.81  Aligned_cols=26  Identities=15%  Similarity=0.226  Sum_probs=23.8

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||+-|+++.+-+.|+-+|
T Consensus       156 aG~Id~~eAr~RR~~l~~EadFyGAM  181 (584)
T PRK05910        156 SGRASYSRVSKQKNSLLEESDFFSAM  181 (584)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHhcccc
Confidence            48999999999999999888998887


No 29 
>PF12209 SAC3:  Leucine permease transcriptional regulator helical domain;  InterPro: IPR024293 This domain is found in fungal proteins, including the nuclear mRNA export protein SAC3. It has been suggested this domain provides a scaffold within the yeast Sac3:Cdc31:Sus1:Thp1 (TREX-2) complex to integrate interactions between protein complexes to facilitate the coupling of transcription and mRNA export during gene expression [].; PDB: 3FWC_N 3FWB_B.
Probab=23.62  E-value=95  Score=21.62  Aligned_cols=36  Identities=19%  Similarity=0.342  Sum_probs=24.1

Q ss_pred             cCCCcccHHHHHHHHHHhhhhhh-------hHHHHHHHHHHHH
Q 033081           75 FSPGCFTEEKAKQLRLMTKDTAS-------FHDAMYHSAIASR  110 (128)
Q Consensus        75 F~~G~lTEEKAkqLR~~~~etes-------FHD~MYHSAIASR  110 (128)
                      ++.-+|.++.+++.|+++.++=+       +|+.||.-..-|+
T Consensus        21 ~l~~~l~~~n~~~~R~~iI~sLs~ELy~AFi~E~~Y~~~lesk   63 (79)
T PF12209_consen   21 ILKNLLRRQNARKERKQIIDSLSEELYDAFIHEQLYQIYLESK   63 (79)
T ss_dssp             HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33347889999999999976544       5888888777665


No 30 
>cd00307 RuBisCO_small_like Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit and related proteins. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits. This superfamily also contains specific proteins from cyanobacteria. CcmM plays a role in a CO2 concentrating mechanism, which cyanobacteria need to to overcome t
Probab=23.43  E-value=32  Score=24.41  Aligned_cols=11  Identities=9%  Similarity=0.090  Sum_probs=9.2

Q ss_pred             CccccccCCCC
Q 033081           36 NWWSPLFGWSS   46 (128)
Q Consensus        36 ~WWaPLfGWS~   46 (128)
                      .||.|+||-.+
T Consensus        31 ~w~lp~f~~~~   41 (84)
T cd00307          31 SSWQSCGPIEG   41 (84)
T ss_pred             hhcCCCCCCCC
Confidence            69999999843


No 31 
>PF10231 DUF2315:  Uncharacterised conserved protein (DUF2315);  InterPro: IPR018796  This entry consists of small conserved proteins found from worms to humans. Their function is not known. 
Probab=23.34  E-value=1.3e+02  Score=22.75  Aligned_cols=45  Identities=24%  Similarity=0.432  Sum_probs=27.5

Q ss_pred             CcccCCCCCCCCCchhhHhhhcCCCCCcC-CCcccHHHHHHHHHHhhhhhhhHHHHH
Q 033081           48 ADYIDSESKPENRSESDLEAKSSRSSRFS-PGCFTEEKAKQLRLMTKDTASFHDAMY  103 (128)
Q Consensus        48 ~DYi~~~~~~~~~~e~e~~~~~~r~srF~-~G~lTEEKAkqLR~~~~etesFHD~MY  103 (128)
                      -|||+++.+-++.          |.=.|. +...| +-.++||..-.||..||..-.
T Consensus         2 ~d~igPPd~~SNl----------Rpi~~~~~~nEt-~lE~klR~~Rqe~~~wNq~FW   47 (126)
T PF10231_consen    2 HDWIGPPDPVSNL----------RPIIFHIPENET-PLERKLRLLRQETQEWNQEFW   47 (126)
T ss_pred             CCCcCCCCccCCc----------ceeeccCCCCCC-HHHHHHHHHHHHHHHHHHHHH
Confidence            3778776666554          211222 22334 456788888889999977544


No 32 
>PF08153 NGP1NT:  NGP1NT (NUC091) domain;  InterPro: IPR012971 This N-terminal domain is found in a subfamily of hypothetical nucleolar GTP-binding proteins similar to human NGP1 [].
Probab=22.46  E-value=12  Score=28.78  Aligned_cols=30  Identities=23%  Similarity=0.383  Sum_probs=25.1

Q ss_pred             CCcCCCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           73 SRFSPGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        73 srF~~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      ++.=++.|++.+.|+-|..+.+||+|.|+.
T Consensus        71 ~KLPmsLL~d~~~k~~~~~il~te~F~~tF  100 (130)
T PF08153_consen   71 SKLPMSLLQDSGTKQKRVHILETEPFEDTF  100 (130)
T ss_pred             CcCCHHHhcccccccCCcceeecCCHHHHh
Confidence            566667777777999999999999999974


No 33 
>PRK12792 flhA flagellar biosynthesis protein FlhA; Reviewed
Probab=22.07  E-value=61  Score=30.91  Aligned_cols=26  Identities=19%  Similarity=0.415  Sum_probs=23.7

Q ss_pred             CCcccHHHHHHHHHHhhhhhhhHHHH
Q 033081           77 PGCFTEEKAKQLRLMTKDTASFHDAM  102 (128)
Q Consensus        77 ~G~lTEEKAkqLR~~~~etesFHD~M  102 (128)
                      .|..||+-||+-|+++..-+.|+-+|
T Consensus       169 AGlI~~~eAr~RR~~l~~Ea~FyGAM  194 (694)
T PRK12792        169 AGLIDDKEAQRRRRELEEESAFFGSM  194 (694)
T ss_pred             cCCCCHHHHHHHHHHHHHHHhhcccc
Confidence            48999999999999999888898877


No 34 
>PRK09767 hypothetical protein; Provisional
Probab=21.46  E-value=45  Score=24.61  Aligned_cols=16  Identities=19%  Similarity=0.150  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHhhhhhh
Q 033081           82 EEKAKQLRLMTKDTAS   97 (128)
Q Consensus        82 EEKAkqLR~~~~etes   97 (128)
                      -+.||+||++|.+.|.
T Consensus         6 ~~~ar~lR~~~T~aE~   21 (117)
T PRK09767          6 KSNARDLRRNLTLQER   21 (117)
T ss_pred             HHHHHHHHcCCCHHHH
Confidence            3689999999977664


No 35 
>COG4003 Uncharacterized protein conserved in archaea [Function unknown]
Probab=21.42  E-value=75  Score=23.84  Aligned_cols=17  Identities=41%  Similarity=0.423  Sum_probs=15.1

Q ss_pred             CcccHHHHHHHHHHhhh
Q 033081           78 GCFTEEKAKQLRLMTKD   94 (128)
Q Consensus        78 G~lTEEKAkqLR~~~~e   94 (128)
                      |-+|+|-|+.||..+++
T Consensus        61 GEi~~E~A~~L~~~~~~   77 (98)
T COG4003          61 GEITPEMAKALRVTLVH   77 (98)
T ss_pred             CCCCHHHHHHHHhhHHH
Confidence            88999999999988764


No 36 
>cd09236 V_AnPalA_UmRIM20_like Protein-interacting V-domains of Aspergillus nidulans PalA/RIM20, Ustilago maydis RIM20, and related proteins. This family belongs to the V_Alix_like superfamily which includes the V-shaped (V) domains of Bro1 and Rim20 from Saccharomyces cerevisiae, mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), and related domains. Aspergillus nidulas PalA/RIM20 and Ustilago maydis RIM20, like Saccharomyces cerevisiae Rim20, participate in the response to the external pH via the Pal/Rim101 pathway; however, Saccharomyces cerevisiae Rim20 does not belong to this family. This pathway is a signaling cascade resulting in the activation of the transcription factor PacC/Rim101. The mammalian Alix V-domain (belonging to a different family) contains a binding site, partially conserved in the superfamily, for the retroviral late assembly (L) domain YPXnL motif. Aspergillus nidulas Pa
Probab=21.10  E-value=1.1e+02  Score=25.58  Aligned_cols=32  Identities=16%  Similarity=0.116  Sum_probs=26.3

Q ss_pred             cccHHHHHHHHHHhhhhhhhHHHHHHHHHHHH
Q 033081           79 CFTEEKAKQLRLMTKDTASFHDAMYHSAIASR  110 (128)
Q Consensus        79 ~lTEEKAkqLR~~~~etesFHD~MYHSAIASR  110 (128)
                      .++|+|++.+|....+---.++.+.|+.++|.
T Consensus        10 ~Y~erk~~lVr~~~~~~le~~~~~l~~~L~sl   41 (353)
T cd09236          10 IYDDRKDRLVNESIIDELEELTNRAHSTLRSL   41 (353)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHHHHHHHhC
Confidence            46899999999998666667788888888875


Done!