BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033093
         (127 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CR8|A Chain A, Hexameric Aps Kinase From Thiobacillus Denitrificans
 pdb|3CR8|B Chain B, Hexameric Aps Kinase From Thiobacillus Denitrificans
 pdb|3CR8|C Chain C, Hexameric Aps Kinase From Thiobacillus Denitrificans
          Length = 552

 Score = 26.9 bits (58), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 22/55 (40%)

Query: 8   SLFQNLRRFIKKPWEITGVCSDPEYMGPLRKAAEYRVRCPATPEQQAIIPTSNPE 62
           S  +N    +  P     +   P Y G +R     R R PA   Q +++P   PE
Sbjct: 186 SAIENEANLLLHPQVGGDITEAPAYFGLVRSFLAIRDRFPAATTQLSLLPAPPPE 240


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.134    0.396 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,484,188
Number of Sequences: 62578
Number of extensions: 110499
Number of successful extensions: 129
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 127
Number of HSP's gapped (non-prelim): 2
length of query: 127
length of database: 14,973,337
effective HSP length: 87
effective length of query: 40
effective length of database: 9,529,051
effective search space: 381162040
effective search space used: 381162040
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)