Query         033093
Match_columns 127
No_of_seqs    24 out of 26
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:43:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033093.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033093hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07347 CI-B14_5a:  NADH:ubiqu  96.4  0.0047   1E-07   45.3   4.1   62    8-83      2-63  (97)
  2 KOG4630 NADH:ubiquinone oxidor  93.5    0.14 3.1E-06   40.1   4.6   65    5-82      8-73  (142)
  3 KOG0426 Ubiquitin-protein liga  35.6      87  0.0019   25.2   4.7   20    1-20      1-20  (165)
  4 COG3211 PhoX Predicted phospha  20.3      32 0.00068   32.7  -0.2   27   11-37    542-570 (616)
  5 KOG2406 MADS box transcription  19.0      38 0.00083   32.1   0.0   20   19-38    286-305 (635)
  6 COG5078 Ubiquitin-protein liga  18.3 1.6E+02  0.0034   23.0   3.3   20    1-20      1-21  (153)
  7 PRK13658 hypothetical protein;  17.5      47   0.001   22.9   0.2    7   17-23     53-59  (59)
  8 PF11737 DUF3300:  Protein of u  17.3      86  0.0019   26.4   1.7   22   44-66    135-156 (237)
  9 cd01211 GAPCenA GAPCenA Phosph  17.1 1.4E+02  0.0031   23.1   2.7   14   63-76     68-84  (125)
 10 PF10913 DUF2706:  Protein of u  15.8 1.2E+02  0.0027   20.9   1.9   18   17-34     22-39  (60)

No 1  
>PF07347 CI-B14_5a:  NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a);  InterPro: IPR009947  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family contains the eukaryotic NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a). This is approximately 100 residues long, and forms part of a multiprotein complex that resides on the inner mitochondrial membrane [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport, 0005743 mitochondrial inner membrane
Probab=96.43  E-value=0.0047  Score=45.31  Aligned_cols=62  Identities=29%  Similarity=0.411  Sum_probs=45.6

Q ss_pred             HHHHHHHHhhcCCceeeecCCCCccccccccccccccCCCCCCCceeecCCCCCcceeeeeeeecccccCCCccce
Q 033093            8 SLFQNLRRFIKKPWEITGVCSDPEYMGPLRKAAEYRVRCPATPEQQAIIPTSNPETVYDIKYYSRDQRRNRPPIRR   83 (127)
Q Consensus         8 sl~q~l~r~ik~PW~iTGP~S~pEy~~~~p~a~EYR~~sPAs~~~~~~VP~s~pe~VYDIkY~tRD~RRn~~pi~r   83 (127)
                      -++|.||.|+      .|    =++...+--+.   ..|+-|||. +.+|...-+...+.-||+||.||.-.|-.-
T Consensus         2 p~iq~lR~fl------~G----R~~~~~lRy~d---~~s~RTqPp-P~lP~Gp~hkls~NyYy~RD~RRev~PP~~   63 (97)
T PF07347_consen    2 PFIQRLRNFL------LG----RKHKLQLRYAD---TISPRTQPP-PNLPGGPSHKLSANYYYTRDARREVQPPID   63 (97)
T ss_pred             hHHHHHHHHH------cc----ccccccccccc---ccccCCCCC-CCCCCCCccccccccccccccccccCCCeE
Confidence            3678888876      12    24444333332   389999998 999999999999999999999998665443


No 2  
>KOG4630 consensus NADH:ubiquinone oxidoreductase, NDUFA7/B14.5A subunit [Energy production and conversion]
Probab=93.50  E-value=0.14  Score=40.07  Aligned_cols=65  Identities=29%  Similarity=0.416  Sum_probs=47.2

Q ss_pred             HHHHHHHHHHHhhcCCceeeecCCCCcccccccccccccc-CCCCCCCceeecCCCCCcceeeeeeeecccccCCCccc
Q 033093            5 AATSLFQNLRRFIKKPWEITGVCSDPEYMGPLRKAAEYRV-RCPATPEQQAIIPTSNPETVYDIKYYSRDQRRNRPPIR   82 (127)
Q Consensus         5 a~ksl~q~l~r~ik~PW~iTGP~S~pEy~~~~p~a~EYR~-~sPAs~~~~~~VP~s~pe~VYDIkY~tRD~RRn~~pi~   82 (127)
                      ++.-|+|.+|-||      +|+-    |.+-+  +.-|-. .||-|||. +.||.......++--|+|||-||+-.|-.
T Consensus         8 vAt~ll~r~Rn~l------~g~~----~qhkl--a~rf~d~~sprTqpp-P~lP~GpshkL~aNYY~TRDgRR~v~pp~   73 (142)
T KOG4630|consen    8 VATVLLQRDRNFL------LGRP----YQHKL--ALRFTDSASPRTQPP-PALPGGPSHKLSANYYCTRDGRREVDPPK   73 (142)
T ss_pred             HHHHHHHHHhhhc------cCcc----ccCcc--cccchhccCcccCCC-CCCCCCcccccccceeeecCCccccCchH
Confidence            3444889999886      4432    43322  222322 68999998 88999999999999999999999876654


No 3  
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones]
Probab=35.60  E-value=87  Score=25.18  Aligned_cols=20  Identities=25%  Similarity=0.426  Sum_probs=17.1

Q ss_pred             ChhHHHHHHHHHHHHhhcCC
Q 033093            1 MAKAAATSLFQNLRRFIKKP   20 (127)
Q Consensus         1 ma~~a~ksl~q~l~r~ik~P   20 (127)
                      ||+.|.+.|+..++..++.|
T Consensus         1 m~~~AlkRLm~EykqLt~~~   20 (165)
T KOG0426|consen    1 MAGTALKRLMAEYKQLTLNP   20 (165)
T ss_pred             CchhHHHHHHHHHHHHccCC
Confidence            88999999998888877655


No 4  
>COG3211 PhoX Predicted phosphatase [General function prediction only]
Probab=20.32  E-value=32  Score=32.65  Aligned_cols=27  Identities=30%  Similarity=0.580  Sum_probs=22.1

Q ss_pred             HHHHHhhcCCc--eeeecCCCCccccccc
Q 033093           11 QNLRRFIKKPW--EITGVCSDPEYMGPLR   37 (127)
Q Consensus        11 q~l~r~ik~PW--~iTGP~S~pEy~~~~p   37 (127)
                      -+++||+-.|=  ||||||-+|+.+-...
T Consensus       542 g~~~rf~t~P~g~E~tG~~FspD~~TlFV  570 (616)
T COG3211         542 GTIKRFLTGPIGCEFTGPCFSPDGKTLFV  570 (616)
T ss_pred             ceeeeeccCCCcceeecceeCCCCceEEE
Confidence            35788999998  9999999999775543


No 5  
>KOG2406 consensus MADS box transcription factor [Transcription]
Probab=19.04  E-value=38  Score=32.10  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=17.9

Q ss_pred             CCceeeecCCCCcccccccc
Q 033093           19 KPWEITGVCSDPEYMGPLRK   38 (127)
Q Consensus        19 ~PW~iTGP~S~pEy~~~~p~   38 (127)
                      ++|.++-|+|||+|+++..+
T Consensus       286 r~yhlps~vsd~dy~ea~LG  305 (635)
T KOG2406|consen  286 RGYHLPSPVSDPDYEEAELG  305 (635)
T ss_pred             CCcCCCCCCCChhHHHHHhc
Confidence            49999999999999998765


No 6  
>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones]
Probab=18.33  E-value=1.6e+02  Score=23.00  Aligned_cols=20  Identities=30%  Similarity=0.602  Sum_probs=16.2

Q ss_pred             ChhH-HHHHHHHHHHHhhcCC
Q 033093            1 MAKA-AATSLFQNLRRFIKKP   20 (127)
Q Consensus         1 ma~~-a~ksl~q~l~r~ik~P   20 (127)
                      |+.+ |.+-|.+-++++.+-|
T Consensus         1 ~~s~~a~~RL~kE~~~l~~~~   21 (153)
T COG5078           1 MSSPSALKRLLKELKKLQKDP   21 (153)
T ss_pred             CCchhHHHHHHHHHHHHhcCC
Confidence            4555 8888999999988888


No 7  
>PRK13658 hypothetical protein; Provisional
Probab=17.49  E-value=47  Score=22.91  Aligned_cols=7  Identities=71%  Similarity=1.407  Sum_probs=5.7

Q ss_pred             hcCCcee
Q 033093           17 IKKPWEI   23 (127)
Q Consensus        17 ik~PW~i   23 (127)
                      -|+||+|
T Consensus        53 pkaPwei   59 (59)
T PRK13658         53 PKAPWEI   59 (59)
T ss_pred             CCCCCCC
Confidence            5889986


No 8  
>PF11737 DUF3300:  Protein of unknown function (DUF3300);  InterPro: IPR021728  This hypothetical bacterial gene product has a long hydrophobic segment and is thus likely to be a membrane protein. 
Probab=17.30  E-value=86  Score=26.36  Aligned_cols=22  Identities=41%  Similarity=0.683  Sum_probs=18.0

Q ss_pred             cCCCCCCCceeecCCCCCcceee
Q 033093           44 VRCPATPEQQAIIPTSNPETVYD   66 (127)
Q Consensus        44 ~~sPAs~~~~~~VP~s~pe~VYD   66 (127)
                      .+-||.+.+ +.||..+|..||-
T Consensus       135 ~IePa~p~v-VYVP~YdP~vVYg  156 (237)
T PF11737_consen  135 VIEPAQPEV-VYVPYYDPAVVYG  156 (237)
T ss_pred             EEecCCCCe-EEecCCCCceeeC
Confidence            456776666 9999999999998


No 9  
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain. GAPCenA Phosphotyrosine-binding (PTB) domain. GAPCenA is a centrosome-associated GTPase activating protein (GAP) for rab 6. It consists of an N-terminal PTB domain and a C-terminal TBC domain.  PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=17.07  E-value=1.4e+02  Score=23.09  Aligned_cols=14  Identities=14%  Similarity=0.491  Sum_probs=11.4

Q ss_pred             ceeeeeeeec---cccc
Q 033093           63 TVYDIKYYSR---DQRR   76 (127)
Q Consensus        63 ~VYDIkY~tR---D~RR   76 (127)
                      .||.|.|+.|   |+.-
T Consensus        68 ~I~rI~fC~rG~~~t~e   84 (125)
T cd01211          68 SIVNIRFCIRGESSTSE   84 (125)
T ss_pred             EEEEEEEEEecCCCCcc
Confidence            4899999999   7654


No 10 
>PF10913 DUF2706:  Protein of unknown function (DUF2706);  InterPro: IPR024444 This family of proteins with unknown function appears to be restricted to Rickettsia spp.
Probab=15.76  E-value=1.2e+02  Score=20.85  Aligned_cols=18  Identities=22%  Similarity=0.473  Sum_probs=15.1

Q ss_pred             hcCCceeeecCCCCcccc
Q 033093           17 IKKPWEITGVCSDPEYMG   34 (127)
Q Consensus        17 ik~PW~iTGP~S~pEy~~   34 (127)
                      =.+|+||..||-++|--+
T Consensus        22 psapyeikspcvs~didd   39 (60)
T PF10913_consen   22 PSAPYEIKSPCVSADIDD   39 (60)
T ss_pred             CCCCccccCCccccccCC
Confidence            368999999999998654


Done!