Citrus Sinensis ID: 033098


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MEAAAQEQQNKSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPDVLFLSVDVDDVKDVASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSIRVYVA
cHHHHHHccccccEEEEEcHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHHc
****************VDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPDVLFLSVDVDDVKDVASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSIRVY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAAAQEQQNKSRVVKVDSVESWETFVSQANNQGCPVVVHFTAIWCMPSVAMNPLFEELASAYPDVLFLSVDVDDVKDVASKLEVKAMPTFLLMREGAVVDKLVGANPEEIRKRIDSFVQSIRVYVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin-like protein CXXS1 probableQ0J9V5
Thioredoxin-like protein CXXS1 Possesses low disulfide reductase activity, but efficient protein disulfide isomerase activity. Does not possess deglutathionylation activity.probableQ8LDI5
Thioredoxin Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (By similarity). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.probableO97680

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 11-121
View the alignment between query and template
View the model in PyMOL