Query         033105
Match_columns 127
No_of_seqs    245 out of 1168
Neff          7.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:52:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033105.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033105hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1187 Serine/threonine prote  98.6 4.3E-08 9.3E-13   78.3   4.7   58    3-60    296-355 (361)
  2 PLN00113 leucine-rich repeat r  96.9  0.0019 4.1E-08   56.9   5.6   52    8-59    900-953 (968)
  3 cd05038 PTKc_Jak_rpt2 Catalyti  95.1   0.025 5.4E-07   42.0   3.4   31   27-57    253-283 (284)
  4 cd05080 PTKc_Tyk2_rpt2 Catalyt  95.0   0.018 3.8E-07   43.1   2.4   32   27-58    251-282 (283)
  5 cd05101 PTKc_FGFR2 Catalytic d  94.8   0.052 1.1E-06   41.1   4.5   37   27-63    266-302 (304)
  6 cd05102 PTKc_VEGFR3 Catalytic   94.8   0.039 8.6E-07   42.5   3.8   32   28-59    305-336 (338)
  7 cd05045 PTKc_RET Catalytic dom  94.7   0.054 1.2E-06   40.7   4.3   33   27-59    256-288 (290)
  8 cd05053 PTKc_FGFR Catalytic do  94.7   0.046   1E-06   41.0   3.9   33   26-58    260-292 (293)
  9 cd05063 PTKc_EphR_A2 Catalytic  94.6   0.053 1.2E-06   40.0   4.0   31   27-57    237-267 (268)
 10 cd05094 PTKc_TrkC Catalytic do  94.3   0.062 1.3E-06   40.5   3.9   33   27-59    252-284 (291)
 11 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  94.3   0.054 1.2E-06   40.4   3.6   31   27-57    253-283 (284)
 12 cd05054 PTKc_VEGFR Catalytic d  94.3   0.062 1.4E-06   41.8   4.0   33   27-59    303-335 (337)
 13 cd05033 PTKc_EphR Catalytic do  94.2   0.069 1.5E-06   39.4   3.9   31   27-57    235-265 (266)
 14 cd05097 PTKc_DDR_like Catalyti  94.2   0.055 1.2E-06   40.8   3.4   29   27-55    266-294 (295)
 15 cd05068 PTKc_Frk_like Catalyti  94.2   0.056 1.2E-06   39.8   3.4   31   26-56    230-260 (261)
 16 cd05052 PTKc_Abl Catalytic dom  94.1   0.076 1.7E-06   39.2   4.0   31   27-57    232-262 (263)
 17 cd05148 PTKc_Srm_Brk Catalytic  94.1   0.059 1.3E-06   39.6   3.3   30   27-56    231-260 (261)
 18 cd05047 PTKc_Tie Catalytic dom  94.1   0.065 1.4E-06   39.8   3.6   32   27-58    238-269 (270)
 19 cd05103 PTKc_VEGFR2 Catalytic   94.0   0.068 1.5E-06   41.6   3.7   32   28-59    310-341 (343)
 20 cd05051 PTKc_DDR Catalytic dom  94.0   0.059 1.3E-06   40.4   3.3   29   27-55    267-295 (296)
 21 cd05112 PTKc_Itk Catalytic dom  93.9   0.066 1.4E-06   39.2   3.3   28   27-54    228-255 (256)
 22 cd05035 PTKc_Axl_like Catalyti  93.9   0.077 1.7E-06   39.0   3.7   32   26-57    241-272 (273)
 23 cd05075 PTKc_Axl Catalytic dom  93.9   0.074 1.6E-06   39.3   3.5   31   27-57    241-271 (272)
 24 cd05058 PTKc_Met_Ron Catalytic  93.8   0.093   2E-06   38.5   3.9   32   27-58    229-260 (262)
 25 cd05098 PTKc_FGFR1 Catalytic d  93.8    0.11 2.5E-06   39.4   4.5   35   27-61    269-303 (307)
 26 cd05050 PTKc_Musk Catalytic do  93.7   0.078 1.7E-06   39.7   3.5   29   27-55    259-287 (288)
 27 cd05048 PTKc_Ror Catalytic Dom  93.7   0.064 1.4E-06   39.9   3.0   30   27-56    253-282 (283)
 28 cd05079 PTKc_Jak1_rpt2 Catalyt  93.7   0.098 2.1E-06   39.1   4.0   31   27-57    253-283 (284)
 29 cd05093 PTKc_TrkB Catalytic do  93.7     0.1 2.2E-06   39.2   4.0   34   27-60    249-282 (288)
 30 cd05043 PTK_Ryk Pseudokinase d  93.6    0.11 2.5E-06   38.6   4.1   32   28-59    247-278 (280)
 31 PHA02988 hypothetical protein;  93.6    0.12 2.6E-06   39.1   4.3   32   27-58    249-280 (283)
 32 PF07714 Pkinase_Tyr:  Protein   93.5   0.066 1.4E-06   39.8   2.7   28   27-54    232-259 (259)
 33 cd05060 PTKc_Syk_like Catalyti  93.4   0.095 2.1E-06   38.5   3.4   31   27-57    225-255 (257)
 34 cd05095 PTKc_DDR2 Catalytic do  93.3    0.11 2.5E-06   39.1   3.8   29   27-55    267-295 (296)
 35 cd05074 PTKc_Tyro3 Catalytic d  93.2    0.12 2.6E-06   38.2   3.7   32   26-57    241-272 (273)
 36 cd05114 PTKc_Tec_Rlk Catalytic  93.2     0.1 2.3E-06   38.2   3.4   27   28-54    229-255 (256)
 37 cd05104 PTKc_Kit Catalytic dom  93.2   0.082 1.8E-06   41.8   2.9   29   28-56    345-373 (375)
 38 cd05089 PTKc_Tie1 Catalytic do  93.1    0.15 3.3E-06   38.5   4.2   36   27-62    245-280 (297)
 39 cd05084 PTKc_Fes Catalytic dom  93.1    0.11 2.4E-06   38.0   3.3   29   27-55    223-251 (252)
 40 cd05072 PTKc_Lyn Catalytic dom  93.1    0.11 2.3E-06   38.3   3.2   30   27-56    231-260 (261)
 41 cd08528 STKc_Nek10 Catalytic d  92.9    0.13 2.9E-06   37.9   3.6   29   27-55    240-268 (269)
 42 cd05066 PTKc_EphR_A Catalytic   92.9    0.15 3.3E-06   37.7   3.8   31   27-57    236-266 (267)
 43 cd05085 PTKc_Fer Catalytic dom  92.9    0.13 2.8E-06   37.4   3.4   29   27-55    221-249 (250)
 44 cd05096 PTKc_DDR1 Catalytic do  92.8    0.13 2.9E-06   38.9   3.5   29   27-55    275-303 (304)
 45 cd05036 PTKc_ALK_LTK Catalytic  92.7    0.15 3.2E-06   38.0   3.6   29   27-55    248-276 (277)
 46 cd08229 STKc_Nek7 Catalytic do  92.7    0.19 4.2E-06   36.9   4.1   30   28-57    236-265 (267)
 47 cd05059 PTKc_Tec_like Catalyti  92.7    0.13 2.7E-06   37.9   3.1   28   27-54    228-255 (256)
 48 cd08228 STKc_Nek6 Catalytic do  92.6    0.17 3.6E-06   37.3   3.8   31   27-57    235-265 (267)
 49 cd05106 PTKc_CSF-1R Catalytic   92.6    0.15 3.3E-06   40.3   3.7   32   27-58    342-373 (374)
 50 cd05091 PTKc_Ror2 Catalytic do  92.5    0.14 2.9E-06   38.2   3.2   30   27-56    253-282 (283)
 51 cd05065 PTKc_EphR_B Catalytic   92.5    0.17 3.7E-06   37.4   3.7   31   27-57    238-268 (269)
 52 cd05078 PTK_Jak2_Jak3_rpt1 Pse  92.4     0.1 2.2E-06   38.5   2.4   29   27-55    230-258 (258)
 53 cd05062 PTKc_IGF-1R Catalytic   92.4    0.15 3.3E-06   37.9   3.3   29   27-55    248-276 (277)
 54 cd05113 PTKc_Btk_Bmx Catalytic  92.3    0.14 3.1E-06   37.7   3.1   29   27-55    228-256 (256)
 55 cd05071 PTKc_Src Catalytic dom  92.2    0.23 4.9E-06   36.8   4.1   33   25-57    228-260 (262)
 56 cd05082 PTKc_Csk Catalytic dom  92.2    0.15 3.2E-06   37.5   3.0   30   27-56    226-255 (256)
 57 cd05099 PTKc_FGFR4 Catalytic d  92.2    0.26 5.6E-06   37.6   4.4   33   27-59    263-295 (314)
 58 cd05111 PTK_HER3 Pseudokinase   92.2    0.27 5.8E-06   36.8   4.5   32   28-59    239-270 (279)
 59 cd05039 PTKc_Csk_like Catalyti  92.2    0.16 3.4E-06   37.2   3.1   30   27-56    226-255 (256)
 60 cd05088 PTKc_Tie2 Catalytic do  92.1    0.23   5E-06   37.7   4.0   34   28-61    251-284 (303)
 61 cd05100 PTKc_FGFR3 Catalytic d  92.1    0.24 5.2E-06   38.2   4.2   36   27-62    263-298 (334)
 62 cd05055 PTKc_PDGFR Catalytic d  92.0    0.23 4.9E-06   37.8   3.9   31   27-57    271-301 (302)
 63 cd05069 PTKc_Yes Catalytic dom  91.9    0.25 5.3E-06   36.4   3.8   30   27-56    230-259 (260)
 64 cd05044 PTKc_c-ros Catalytic d  91.8    0.25 5.4E-06   36.3   3.9   29   27-55    240-268 (269)
 65 cd08224 STKc_Nek6_Nek7 Catalyt  91.6    0.31 6.7E-06   35.7   4.2   30   28-57    236-265 (267)
 66 cd05076 PTK_Tyk2_rpt1 Pseudoki  91.6    0.19   4E-06   37.7   3.0   27   28-54    247-273 (274)
 67 cd05116 PTKc_Syk Catalytic dom  91.6    0.22 4.8E-06   36.6   3.4   30   27-56    225-254 (257)
 68 cd05049 PTKc_Trk Catalytic dom  91.5    0.26 5.6E-06   36.5   3.7   29   27-55    251-279 (280)
 69 cd05070 PTKc_Fyn_Yrk Catalytic  91.5    0.26 5.6E-06   36.2   3.6   30   27-56    230-259 (260)
 70 cd05061 PTKc_InsR Catalytic do  91.4    0.24 5.1E-06   37.2   3.4   32   27-58    248-279 (288)
 71 cd05107 PTKc_PDGFR_beta Cataly  91.2    0.24 5.2E-06   39.9   3.5   32   27-58    369-400 (401)
 72 cd05064 PTKc_EphR_A10 Catalyti  91.2    0.31 6.8E-06   36.1   3.9   31   27-57    235-265 (266)
 73 cd05041 PTKc_Fes_like Catalyti  90.9    0.27 5.9E-06   35.8   3.2   29   27-55    222-250 (251)
 74 cd05032 PTKc_InsR_like Catalyt  90.6    0.31 6.7E-06   36.0   3.3   30   26-55    247-276 (277)
 75 cd05040 PTKc_Ack_like Catalyti  90.6    0.37   8E-06   35.2   3.7   29   27-55    228-256 (257)
 76 cd05110 PTKc_HER4 Catalytic do  90.6    0.42   9E-06   36.2   4.1   32   27-58    238-269 (303)
 77 cd05108 PTKc_EGFR Catalytic do  90.5    0.38 8.2E-06   36.7   3.8   34   27-60    238-271 (316)
 78 cd05105 PTKc_PDGFR_alpha Catal  90.5    0.26 5.6E-06   39.7   3.0   32   27-58    367-398 (400)
 79 cd00192 PTKc Catalytic domain   90.5    0.28 6.1E-06   35.5   3.0   29   27-55    234-262 (262)
 80 cd05056 PTKc_FAK Catalytic dom  90.4    0.44 9.6E-06   35.1   4.1   32   28-59    236-267 (270)
 81 cd05067 PTKc_Lck_Blk Catalytic  90.4    0.35 7.6E-06   35.5   3.5   30   27-56    230-259 (260)
 82 cd05037 PTK_Jak_rpt1 Pseudokin  90.3    0.25 5.3E-06   36.0   2.5   28   27-54    231-258 (259)
 83 cd05109 PTKc_HER2 Catalytic do  90.2    0.42 9.1E-06   35.5   3.8   34   27-60    238-271 (279)
 84 smart00750 KIND kinase non-cat  90.2    0.48   1E-05   32.7   3.9   31   28-58    140-170 (176)
 85 cd05083 PTKc_Chk Catalytic dom  90.2    0.34 7.3E-06   35.5   3.2   29   27-55    224-252 (254)
 86 cd05090 PTKc_Ror1 Catalytic do  89.8    0.44 9.6E-06   35.5   3.6   29   27-55    253-281 (283)
 87 cd05073 PTKc_Hck Catalytic dom  89.7    0.48   1E-05   34.8   3.7   30   27-56    230-259 (260)
 88 cd05034 PTKc_Src_like Catalyti  89.6    0.48   1E-05   34.7   3.6   30   27-56    231-260 (261)
 89 cd05092 PTKc_TrkA Catalytic do  89.4    0.45 9.7E-06   35.5   3.4   29   27-55    251-279 (280)
 90 cd05115 PTKc_Zap-70 Catalytic   89.3    0.48   1E-05   34.9   3.5   31   27-57    225-255 (257)
 91 cd05077 PTK_Jak1_rpt1 Pseudoki  88.9    0.41   9E-06   35.5   2.9   28   27-54    234-261 (262)
 92 smart00219 TyrKc Tyrosine kina  88.4    0.45 9.7E-06   34.5   2.7   28   27-54    231-258 (258)
 93 cd05057 PTKc_EGFR_like Catalyt  87.6    0.96 2.1E-05   33.6   4.2   33   27-59    238-270 (279)
 94 smart00220 S_TKc Serine/Threon  87.6    0.63 1.4E-05   32.9   3.0   26   27-52    215-240 (244)
 95 cd08217 STKc_Nek2 Catalytic do  87.5    0.62 1.3E-05   33.8   3.0   26   27-52    236-261 (265)
 96 cd05046 PTK_CCK4 Pseudokinase   86.8    0.82 1.8E-05   33.7   3.4   29   27-55    246-274 (275)
 97 cd08529 STKc_FA2-like Catalyti  86.8    0.73 1.6E-05   33.4   3.0   27   27-53    227-253 (256)
 98 cd08218 STKc_Nek1 Catalytic do  86.4    0.67 1.5E-05   33.8   2.7   26   27-52    227-252 (256)
 99 cd06642 STKc_STK25-YSK1 Cataly  86.1    0.87 1.9E-05   33.8   3.2   27   27-53    227-253 (277)
100 cd07835 STKc_CDK1_like Catalyt  85.4    0.71 1.5E-05   34.2   2.4   26   27-52    254-279 (283)
101 cd06621 PKc_MAPKK_Pek1_like Ca  85.0     1.1 2.3E-05   33.6   3.2   26   27-52    240-265 (287)
102 cd07846 STKc_CDKL2_3 Catalytic  84.8    0.89 1.9E-05   33.7   2.7   26   27-52    257-282 (286)
103 cd05087 PTKc_Aatyk1_Aatyk3 Cat  84.5    0.86 1.9E-05   33.6   2.5   25   30-55    244-268 (269)
104 cd06638 STKc_myosinIIIA Cataly  84.4     1.2 2.6E-05   33.1   3.2   26   28-53    258-283 (286)
105 cd08223 STKc_Nek4 Catalytic do  84.4     1.1 2.3E-05   32.6   2.9   26   27-52    228-253 (257)
106 cd06606 STKc_MAPKKK Catalytic   84.0     1.2 2.6E-05   32.0   3.0   26   27-52    231-256 (260)
107 cd07833 STKc_CDKL Catalytic do  84.0    0.84 1.8E-05   33.8   2.2   26   27-52    259-284 (288)
108 cd06612 STKc_MST1_2 Catalytic   83.9    0.89 1.9E-05   33.0   2.3   25   28-52    228-252 (256)
109 cd07840 STKc_CDK9_like Catalyt  83.6     1.2 2.6E-05   32.8   2.9   26   27-52    258-283 (287)
110 cd07831 STKc_MOK Catalytic dom  83.3     1.2 2.7E-05   32.8   2.9   26   27-52    253-278 (282)
111 cd06624 STKc_ASK Catalytic dom  83.1     1.4   3E-05   32.4   3.1   26   27-52    239-264 (268)
112 cd08226 PK_STRAD_beta Pseudoki  82.9     2.1 4.5E-05   32.8   4.1   29   25-53    280-308 (328)
113 cd05118 STKc_CMGC Catalytic do  82.8     1.4 3.1E-05   32.4   3.1   26   27-52    254-279 (283)
114 cd07830 STKc_MAK_like Catalyti  82.8     1.4   3E-05   32.6   3.0   26   27-52    254-279 (283)
115 cd06620 PKc_MAPKK_Byr1_like Ca  82.7     1.2 2.7E-05   33.1   2.7   30   27-56    240-269 (284)
116 cd06608 STKc_myosinIII_like Ca  82.6     1.2 2.5E-05   32.6   2.5   25   28-52    247-271 (275)
117 cd08220 STKc_Nek8 Catalytic do  82.5     1.3 2.8E-05   32.1   2.7   25   28-52    228-252 (256)
118 cd08225 STKc_Nek5 Catalytic do  82.5     1.3 2.7E-05   32.2   2.6   25   28-52    229-253 (257)
119 cd06640 STKc_MST4 Catalytic do  82.5     1.5 3.2E-05   32.6   3.1   29   25-53    225-253 (277)
120 KOG2345 Serine/threonine prote  82.0       2 4.3E-05   33.5   3.6   31   27-57    270-300 (302)
121 cd07841 STKc_CDK7 Catalytic do  81.9     1.5 3.2E-05   32.8   2.9   26   27-52    256-281 (298)
122 cd00180 PKc Catalytic domain o  81.6     1.3 2.7E-05   30.3   2.3   27   27-53    188-214 (215)
123 cd05086 PTKc_Aatyk2 Catalytic   81.4     1.8   4E-05   31.9   3.2   25   30-55    243-267 (268)
124 cd06637 STKc_TNIK Catalytic do  81.2     1.6 3.5E-05   32.0   2.9   25   28-52    244-268 (272)
125 cd06646 STKc_MAP4K5 Catalytic   81.1       1 2.2E-05   33.1   1.7   27   27-53    239-265 (267)
126 cd06649 PKc_MEK2 Catalytic dom  81.1     1.5 3.3E-05   33.7   2.8   27   28-54    276-302 (331)
127 PF00069 Pkinase:  Protein kina  80.9     1.3 2.8E-05   32.1   2.2   26   27-52    231-256 (260)
128 cd06615 PKc_MEK Catalytic doma  80.8     1.4   3E-05   33.5   2.4   28   28-55    262-289 (308)
129 cd05122 PKc_STE Catalytic doma  80.6     1.5 3.2E-05   31.3   2.4   26   27-52    225-250 (253)
130 cd06609 STKc_MST3_like Catalyt  80.2     1.7 3.8E-05   32.0   2.7   25   28-52    226-250 (274)
131 cd07861 STKc_CDK1_euk Catalyti  80.1     1.6 3.5E-05   32.3   2.5   24   29-52    258-281 (285)
132 cd08216 PK_STRAD Pseudokinase   79.9     1.7 3.8E-05   32.7   2.7   27   27-53    269-295 (314)
133 cd06650 PKc_MEK1 Catalytic dom  79.8     2.1 4.5E-05   33.1   3.1   25   28-52    274-298 (333)
134 cd06629 STKc_MAPKKK_Bck1_like   79.7     1.8 3.9E-05   31.8   2.7   26   27-52    243-268 (272)
135 cd07842 STKc_CDK8_like Catalyt  79.6     1.8 3.9E-05   32.5   2.7   25   28-52    288-312 (316)
136 cd06616 PKc_MKK4 Catalytic dom  79.5     1.6 3.4E-05   32.5   2.3   27   27-53    241-267 (288)
137 cd08221 STKc_Nek9 Catalytic do  79.4     1.8 3.8E-05   31.5   2.5   27   27-53    227-253 (256)
138 cd06639 STKc_myosinIIIB Cataly  79.4     1.5 3.3E-05   32.7   2.2   26   27-52    261-286 (291)
139 cd07860 STKc_CDK2_3 Catalytic   79.4     2.1 4.6E-05   31.7   3.0   24   29-52    257-280 (284)
140 cd06641 STKc_MST3 Catalytic do  79.2     2.2 4.7E-05   31.6   3.0   27   27-53    227-253 (277)
141 cd06610 STKc_OSR1_SPAK Catalyt  79.0     2.1 4.6E-05   31.1   2.9   26   27-52    238-263 (267)
142 cd06605 PKc_MAPKK Catalytic do  78.9     2.3 5.1E-05   31.0   3.1   25   28-52    232-256 (265)
143 cd06618 PKc_MKK7 Catalytic dom  78.8     1.9 4.1E-05   32.4   2.6   27   27-53    247-273 (296)
144 cd08219 STKc_Nek3 Catalytic do  78.7       2 4.4E-05   31.2   2.7   26   28-53    227-252 (255)
145 cd08227 PK_STRAD_alpha Pseudok  78.4     1.6 3.5E-05   33.4   2.1   25   28-52    282-306 (327)
146 cd07847 STKc_CDKL1_4 Catalytic  78.4     2.3   5E-05   31.4   2.9   25   28-52    258-282 (286)
147 cd07829 STKc_CDK_like Catalyti  78.1     2.5 5.3E-05   31.1   3.0   26   27-52    253-278 (282)
148 cd07832 STKc_CCRK Catalytic do  77.9     2.4 5.1E-05   31.3   2.8   26   27-52    256-281 (286)
149 cd07838 STKc_CDK4_6_like Catal  77.7     2.6 5.5E-05   31.1   3.0   26   27-52    258-283 (287)
150 PLN00009 cyclin-dependent kina  77.6     2.2 4.7E-05   31.9   2.6   25   28-52    259-283 (294)
151 cd06619 PKc_MKK5 Catalytic dom  77.6     2.1 4.4E-05   31.9   2.5   26   28-53    228-253 (279)
152 KOG1989 ARK protein kinase fam  77.5     5.2 0.00011   35.3   5.1   51   11-61    265-315 (738)
153 cd06626 STKc_MEKK4 Catalytic d  77.2     2.6 5.6E-05   30.6   2.9   25   28-52    236-260 (264)
154 cd06632 STKc_MEKK1_plant Catal  76.9     2.4 5.2E-05   30.6   2.6   25   28-52    230-254 (258)
155 cd07862 STKc_CDK6 Catalytic do  76.6     2.4 5.1E-05   31.6   2.6   24   29-52    263-286 (290)
156 cd08530 STKc_CNK2-like Catalyt  76.6       3 6.4E-05   30.1   3.0   26   27-52    227-252 (256)
157 cd07858 STKc_TEY_MAPK_plant Ca  76.5     2.3 4.9E-05   32.8   2.5   27   27-53    265-291 (337)
158 cd07837 STKc_CdkB_plant Cataly  76.5     2.4 5.1E-05   31.6   2.5   25   28-52    266-290 (295)
159 cd07852 STKc_MAPK15 Catalytic   76.3     2.7 5.7E-05   32.3   2.8   25   28-52    270-294 (337)
160 cd06613 STKc_MAP4K3_like Catal  76.3     2.6 5.7E-05   30.5   2.7   26   27-52    234-259 (262)
161 cd06917 STKc_NAK1_like Catalyt  76.0     3.2 6.9E-05   30.6   3.1   26   27-52    229-254 (277)
162 cd07865 STKc_CDK9 Catalytic do  75.8     2.7 5.8E-05   31.4   2.7   25   28-52    282-306 (310)
163 cd06627 STKc_Cdc7_like Catalyt  75.7     2.3   5E-05   30.6   2.3   26   27-52    225-250 (254)
164 cd07866 STKc_BUR1 Catalytic do  75.5       3 6.5E-05   31.2   2.9   26   27-52    282-307 (311)
165 cd06607 STKc_TAO Catalytic dom  75.2     2.8   6E-05   31.7   2.6   26   28-53    242-267 (307)
166 cd07844 STKc_PCTAIRE_like Cata  75.1     2.9 6.2E-05   31.1   2.7   26   27-52    262-287 (291)
167 cd06623 PKc_MAPKK_plant_like C  75.1     3.4 7.4E-05   29.9   3.0   26   27-52    230-255 (264)
168 cd08215 STKc_Nek Catalytic dom  74.8       3 6.6E-05   29.9   2.7   26   27-52    229-254 (258)
169 cd08222 STKc_Nek11 Catalytic d  74.4     3.4 7.4E-05   30.1   2.9   26   27-52    231-256 (260)
170 cd06631 STKc_YSK4 Catalytic do  74.3     3.2 6.9E-05   30.4   2.7   25   28-52    237-261 (265)
171 cd07843 STKc_CDC2L1 Catalytic   74.2     3.2 6.9E-05   31.0   2.7   25   28-52    265-289 (293)
172 cd07864 STKc_CDK12 Catalytic d  74.2     3.3 7.1E-05   30.9   2.8   26   27-52    273-298 (302)
173 cd07874 STKc_JNK3 Catalytic do  74.1     3.1 6.6E-05   32.3   2.7   26   28-53    286-311 (355)
174 cd07859 STKc_TDY_MAPK_plant Ca  73.9     3.1 6.8E-05   31.6   2.7   25   29-53    266-290 (338)
175 KOG0194 Protein tyrosine kinas  73.7     5.1 0.00011   33.6   4.0   39   22-63    388-426 (474)
176 cd06635 STKc_TAO1 Catalytic do  73.7     3.3 7.2E-05   31.5   2.8   29   28-56    252-280 (317)
177 cd07851 STKc_p38 Catalytic dom  73.3     3.5 7.5E-05   31.9   2.8   26   27-52    272-297 (343)
178 cd07839 STKc_CDK5 Catalytic do  73.1     3.3 7.1E-05   30.6   2.6   26   27-52    255-280 (284)
179 cd06645 STKc_MAP4K3 Catalytic   73.1     3.6 7.7E-05   30.1   2.7   25   28-52    240-264 (267)
180 cd07849 STKc_ERK1_2_like Catal  73.1     2.9 6.3E-05   32.1   2.3   26   28-53    267-292 (336)
181 cd06643 STKc_SLK Catalytic dom  72.5     3.3 7.1E-05   30.7   2.4   25   28-52    237-261 (282)
182 cd06634 STKc_TAO2 Catalytic do  72.2     4.5 9.7E-05   30.7   3.1   27   28-54    242-268 (308)
183 cd06656 STKc_PAK3 Catalytic do  72.1     3.6 7.8E-05   31.0   2.6   24   29-52    245-268 (297)
184 cd07863 STKc_CDK4 Catalytic do  72.1     3.8 8.3E-05   30.3   2.7   25   28-52    260-284 (288)
185 KOG0192 Tyrosine kinase specif  72.0     7.5 0.00016   31.3   4.5   37   25-61    271-307 (362)
186 cd06654 STKc_PAK1 Catalytic do  71.3     4.4 9.4E-05   30.6   2.9   25   28-52    245-269 (296)
187 cd06628 STKc_MAPKKK_Byr2_like   71.1     4.7  0.0001   29.4   3.0   25   28-52    239-263 (267)
188 cd06611 STKc_SLK_like Catalyti  71.0     3.9 8.4E-05   30.2   2.5   26   28-53    237-262 (280)
189 cd06614 STKc_PAK Catalytic dom  70.9     4.3 9.3E-05   30.1   2.8   26   28-53    245-270 (286)
190 cd06625 STKc_MEKK3_like Cataly  70.9     4.6 9.9E-05   29.4   2.8   26   27-52    234-259 (263)
191 cd06651 STKc_MEKK3 Catalytic d  70.8     3.6 7.9E-05   30.2   2.3   23   30-52    238-260 (266)
192 cd07857 STKc_MPK1 Catalytic do  70.7     5.2 0.00011   30.7   3.2   26   27-52    266-291 (332)
193 PLN00034 mitogen-activated pro  70.4     4.2 9.1E-05   31.6   2.7   25   28-52    303-327 (353)
194 cd06644 STKc_STK10_LOK Catalyt  70.0     4.9 0.00011   30.0   2.9   25   28-52    244-268 (292)
195 cd07848 STKc_CDKL5 Catalytic d  69.8     4.7  0.0001   29.9   2.8   24   29-52    260-283 (287)
196 cd07870 STKc_PFTAIRE2 Catalyti  69.8     4.8  0.0001   29.9   2.8   25   28-52    263-287 (291)
197 cd06636 STKc_MAP4K4_6 Catalyti  69.7     4.3 9.3E-05   30.0   2.5   25   28-52    254-278 (282)
198 cd07879 STKc_p38delta_MAPK13 C  69.3     4.8  0.0001   31.1   2.8   30   28-57    272-303 (342)
199 PHA03209 serine/threonine kina  69.2     3.8 8.3E-05   32.0   2.3   21   32-52    330-350 (357)
200 cd05583 STKc_MSK_N N-terminal   69.2     3.1 6.8E-05   30.9   1.7   30   28-57    238-267 (288)
201 cd06648 STKc_PAK_II Catalytic   68.3     4.3 9.3E-05   30.4   2.3   25   28-52    244-268 (285)
202 cd07850 STKc_JNK Catalytic dom  68.2     5.1 0.00011   31.0   2.8   26   27-52    285-310 (353)
203 cd07836 STKc_Pho85 Catalytic d  68.1       5 0.00011   29.6   2.6   25   28-52    256-280 (284)
204 cd06633 STKc_TAO3 Catalytic do  68.1     4.7  0.0001   30.7   2.5   25   28-52    248-272 (313)
205 cd07855 STKc_ERK5 Catalytic do  67.8     5.4 0.00012   30.6   2.8   27   27-53    268-294 (334)
206 cd06655 STKc_PAK2 Catalytic do  67.5     4.9 0.00011   30.3   2.4   24   29-52    245-268 (296)
207 cd06617 PKc_MKK3_6 Catalytic d  67.2     5.2 0.00011   29.5   2.5   25   28-52    236-260 (283)
208 cd07834 STKc_MAPK Catalytic do  67.2     5.8 0.00013   30.1   2.8   26   28-53    264-289 (330)
209 cd06622 PKc_MAPKK_PBS2_like Ca  66.7     7.2 0.00016   28.9   3.2   26   27-52    236-261 (286)
210 cd07867 STKc_CDC2L6 Catalytic   66.6     5.6 0.00012   29.9   2.6   24   29-52    290-313 (317)
211 PTZ00024 cyclin-dependent prot  66.6       6 0.00013   30.3   2.8   26   27-52    287-312 (335)
212 cd07873 STKc_PCTAIRE1 Catalyti  65.9     5.5 0.00012   29.9   2.5   24   29-52    262-285 (301)
213 cd07856 STKc_Sty1_Hog1 Catalyt  64.9       7 0.00015   30.1   2.9   27   27-53    262-288 (328)
214 cd06630 STKc_MEKK1 Catalytic d  64.4     7.4 0.00016   28.3   2.8   26   27-52    238-263 (268)
215 cd07854 STKc_MAPK4_6 Catalytic  64.0     7.2 0.00016   30.1   2.8   25   28-52    275-299 (342)
216 cd07853 STKc_NLK Catalytic dom  64.0       7 0.00015   30.5   2.8   26   28-53    263-288 (372)
217 cd07845 STKc_CDK10 Catalytic d  63.9     6.3 0.00014   29.7   2.5   25   28-52    265-289 (309)
218 cd05042 PTKc_Aatyk Catalytic d  63.4     9.2  0.0002   28.0   3.2   24   31-55    245-268 (269)
219 cd07875 STKc_JNK1 Catalytic do  61.8     8.5 0.00018   29.9   2.9   25   28-52    293-317 (364)
220 PLN00181 protein SPA1-RELATED;  61.5     7.2 0.00016   34.2   2.7   25   28-52    240-264 (793)
221 cd05579 STKc_MAST_like Catalyt  61.1       5 0.00011   28.9   1.4   29   27-55    228-256 (265)
222 cd07876 STKc_JNK2 Catalytic do  60.2     8.7 0.00019   29.8   2.7   25   29-53    291-315 (359)
223 cd07868 STKc_CDK8 Catalytic do  60.1     8.8 0.00019   29.0   2.7   24   29-52    290-313 (317)
224 cd06659 STKc_PAK6 Catalytic do  59.5      11 0.00024   28.4   3.1   25   29-53    247-271 (297)
225 KOG0596 Dual specificity; seri  59.3     3.9 8.5E-05   35.2   0.6   45    8-52    581-626 (677)
226 cd06658 STKc_PAK5 Catalytic do  59.2     9.4  0.0002   28.7   2.7   25   29-53    248-272 (292)
227 cd06647 STKc_PAK_I Catalytic d  58.4     9.8 0.00021   28.6   2.6   26   28-53    244-269 (293)
228 cd07869 STKc_PFTAIRE1 Catalyti  56.5      11 0.00023   28.4   2.6   25   28-52    263-287 (303)
229 PTZ00283 serine/threonine prot  56.5      12 0.00026   31.1   3.0   25   28-52    272-296 (496)
230 PHA02882 putative serine/threo  56.3      12 0.00027   28.1   2.9   28   27-54    266-293 (294)
231 cd07880 STKc_p38gamma_MAPK12 C  56.2      11 0.00024   29.1   2.6   24   29-52    274-297 (343)
232 PHA03211 serine/threonine kina  55.0      11 0.00024   31.1   2.6   25   29-53    431-455 (461)
233 cd07878 STKc_p38beta_MAPK11 Ca  54.2      13 0.00027   28.6   2.7   24   29-52    274-297 (343)
234 PTZ00284 protein kinase; Provi  53.9      12 0.00026   30.4   2.6   25   28-52    413-437 (467)
235 cd06657 STKc_PAK4 Catalytic do  53.3      13 0.00027   28.1   2.5   24   29-52    246-269 (292)
236 cd05609 STKc_MAST Catalytic do  51.5     9.8 0.00021   28.6   1.6   28   29-56    246-273 (305)
237 PTZ00267 NIMA-related protein   50.8      14 0.00031   30.2   2.6   25   28-52    298-322 (478)
238 cd05581 STKc_PDK1 Catalytic do  49.1      13 0.00028   27.1   1.9   20   28-47    248-267 (280)
239 KOG1095 Protein tyrosine kinas  49.0      41 0.00088   31.1   5.3   41   25-65    929-969 (1025)
240 PHA03212 serine/threonine kina  48.4      16 0.00034   29.2   2.5   25   28-52    351-375 (391)
241 cd07872 STKc_PCTAIRE2 Catalyti  47.3      18 0.00039   27.2   2.5   24   29-52    262-285 (309)
242 cd05611 STKc_Rim15_like Cataly  45.6      12 0.00025   27.2   1.2   28   27-54    222-249 (260)
243 cd07871 STKc_PCTAIRE3 Catalyti  43.1      27 0.00058   26.0   2.9   24   29-52    261-284 (288)
244 KOG0193 Serine/threonine prote  39.6      40 0.00087   29.5   3.6   36   24-59    620-655 (678)
245 PHA03207 serine/threonine kina  38.7      28  0.0006   27.6   2.5   24   30-53    352-375 (392)
246 cd05123 STKc_AGC Catalytic dom  37.6      26 0.00057   25.0   2.0   22   28-49    219-240 (250)
247 cd07877 STKc_p38alpha_MAPK14 C  37.5      29 0.00064   26.8   2.4   25   29-53    276-300 (345)
248 PTZ00036 glycogen synthase kin  37.3      32  0.0007   27.9   2.7   26   28-53    326-351 (440)
249 cd05607 STKc_GRK7 Catalytic do  37.2      17 0.00038   26.9   1.0   27   28-54    225-251 (277)
250 cd05574 STKc_phototropin_like   37.2      30 0.00065   26.0   2.4   30   27-56    259-288 (316)
251 KOG4278 Protein tyrosine kinas  35.9      35 0.00076   30.5   2.7   36   24-59    490-525 (1157)
252 cd05632 STKc_GRK5 Catalytic do  35.1      30 0.00065   25.7   2.0   22   28-49    231-252 (285)
253 cd05610 STKc_MASTL Catalytic d  35.1      32 0.00069   29.7   2.4   25   29-53    610-634 (669)
254 KOG1026 Nerve growth factor re  34.4      58  0.0013   29.2   3.9   39   23-61    728-766 (774)
255 cd05572 STKc_cGK_PKG Catalytic  33.1      39 0.00084   24.4   2.4   21   27-47    221-241 (262)
256 KOG4257 Focal adhesion tyrosin  32.6      82  0.0018   28.2   4.4   40   22-61    614-653 (974)
257 cd05605 STKc_GRK4_like Catalyt  31.5      32 0.00068   25.6   1.7   25   28-52    231-260 (285)
258 KOG0199 ACK and related non-re  30.9      45 0.00098   30.1   2.6   33   23-55    338-370 (1039)
259 cd05600 STKc_Sid2p_Dbf2p Catal  30.3      47   0.001   25.3   2.5   25   29-53    233-257 (333)
260 PHA03210 serine/threonine kina  28.7      57  0.0012   27.0   2.8   23   30-52    431-453 (501)
261 cd05570 STKc_PKC Catalytic dom  28.7      37  0.0008   25.8   1.6   25   28-52    222-251 (318)
262 PLN03225 Serine/threonine-prot  28.6      53  0.0011   27.9   2.7   22   31-52    428-449 (566)
263 KOG1023 Natriuretic peptide re  28.6      55  0.0012   27.6   2.7   33   28-60    195-227 (484)
264 cd05631 STKc_GRK4 Catalytic do  28.5      38 0.00083   25.1   1.7   25   28-52    231-260 (285)
265 KOG0201 Serine/threonine prote  27.4      57  0.0012   27.4   2.5   24   29-52    239-262 (467)
266 cd05608 STKc_GRK1 Catalytic do  26.8      50  0.0011   24.4   2.0   25   28-52    227-256 (280)
267 KOG0196 Tyrosine kinase, EPH (  26.3      80  0.0017   28.8   3.4   41   21-61    855-895 (996)
268 KOG0197 Tyrosine kinases [Sign  25.6 1.1E+02  0.0023   25.9   3.9   35   25-59    429-463 (468)
269 KOG0593 Predicted protein kina  25.1      60  0.0013   26.4   2.2   25   28-52    259-283 (396)
270 cd05578 STKc_Yank1 Catalytic d  24.4      61  0.0013   23.3   2.1   21   27-47    227-247 (258)
271 PRK13184 pknD serine/threonine  24.2      97  0.0021   28.4   3.6   34   28-61    260-294 (932)
272 cd05585 STKc_YPK1_like Catalyt  23.0      38 0.00083   25.6   0.8   26   29-54    220-245 (312)
273 cd05618 STKc_aPKC_iota Catalyt  22.9      63  0.0014   24.7   2.0   20   27-46    230-249 (329)
274 KOG0581 Mitogen-activated prot  22.7      88  0.0019   25.5   2.8   24   29-52    311-334 (364)
275 KOG0582 Ste20-like serine/thre  22.5      87  0.0019   26.6   2.7   25   28-52    268-292 (516)
276 KOG0200 Fibroblast/platelet-de  22.4 1.6E+02  0.0034   25.3   4.4   34   25-58    547-580 (609)
277 cd05582 STKc_RSK_N N-terminal   22.3      71  0.0015   24.1   2.2   21   29-49    225-245 (318)
278 cd05630 STKc_GRK6 Catalytic do  21.8      56  0.0012   24.3   1.5   24   29-52    232-260 (285)
279 cd06652 STKc_MEKK2 Catalytic d  21.7      90  0.0019   22.6   2.5   23   29-52    238-260 (265)
280 cd05592 STKc_nPKC_theta_delta   20.8      71  0.0015   24.2   1.9   23   29-51    223-245 (316)
281 cd05633 STKc_GRK3 Catalytic do  20.3      71  0.0015   23.6   1.8   25   28-52    225-254 (279)
282 PF00440 TetR_N:  Bacterial reg  20.2      55  0.0012   17.8   0.9   27   29-55      1-27  (47)
283 PF07524 Bromo_TP:  Bromodomain  20.1 2.1E+02  0.0046   17.2   3.7   32   26-57     40-71  (77)

No 1  
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=98.62  E-value=4.3e-08  Score=78.29  Aligned_cols=58  Identities=43%  Similarity=0.661  Sum_probs=50.1

Q ss_pred             ccccCCccceecCccc-CCCCH-HHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHh
Q 033105            3 CKNKGLLEEIVDPLIK-VQISP-NSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQL   60 (127)
Q Consensus         3 ~~~~g~l~eivDp~L~-~~~~~-~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~   60 (127)
                      .++++.+.+|+||+|. +.+.. +++.+++.+|++|++.++..||+|.+|++.|+.+...
T Consensus       296 ~~~~~~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~~~~  355 (361)
T KOG1187|consen  296 LLEEGKLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGILSL  355 (361)
T ss_pred             HHHCcchhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhhccc
Confidence            4566789999999997 66665 7999999999999999999999999999999665544


No 2  
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=96.89  E-value=0.0019  Score=56.93  Aligned_cols=52  Identities=31%  Similarity=0.455  Sum_probs=42.9

Q ss_pred             CccceecCcccC--CCCHHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105            8 LLEEIVDPLIKV--QISPNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus         8 ~l~eivDp~L~~--~~~~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ....++||.+..  ....+++..+.+++.+|++.+|.+||+|.+|++.|+.+.+
T Consensus       900 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~~~  953 (968)
T PLN00113        900 HLDMWIDPSIRGDVSVNQNEIVEVMNLALHCTATDPTARPCANDVLKTLESASR  953 (968)
T ss_pred             chhheeCccccCCCCccHHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHhhc
Confidence            345677888754  3456778889999999999999999999999999998765


No 3  
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=95.10  E-value=0.025  Score=41.96  Aligned_cols=31  Identities=16%  Similarity=0.450  Sum_probs=27.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|+..+|.+||++.+|+..|+.+
T Consensus       253 ~~~~~li~~cl~~~p~~Rpt~~ei~~~l~~i  283 (284)
T cd05038         253 DEVYDLMKLCWEAEPQDRPSFADLILIVDRL  283 (284)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHhhc
Confidence            4577888999999999999999999999865


No 4  
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=95.01  E-value=0.018  Score=43.12  Aligned_cols=32  Identities=19%  Similarity=0.310  Sum_probs=28.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+.++..+|++.+|..||++.+|++.|+.+.
T Consensus       251 ~~~~~li~~cl~~~p~~Rps~~~i~~~l~~~~  282 (283)
T cd05080         251 QEVYILMKNCWETEAKFRPTFRSLIPILKEMH  282 (283)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHHHHHhh
Confidence            56778899999999999999999999998753


No 5  
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=94.78  E-value=0.052  Score=41.12  Aligned_cols=37  Identities=22%  Similarity=0.411  Sum_probs=31.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhhhh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQQT   63 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~~~   63 (127)
                      ..+..+..+|++.+|..||++.+|+..|..+..+...
T Consensus       266 ~~~~~li~~cl~~~p~~Rps~~e~l~~l~~~~~~~~~  302 (304)
T cd05101         266 NELYMMMRDCWHAIPSHRPTFKQLVEDLDRILTLTTN  302 (304)
T ss_pred             HHHHHHHHHHcccChhhCCCHHHHHHHHHHHHHhhhc
Confidence            4566788899999999999999999999998877543


No 6  
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=94.75  E-value=0.039  Score=42.49  Aligned_cols=32  Identities=28%  Similarity=0.372  Sum_probs=28.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .+..+..+|++.+|..||++.+++..|+.+..
T Consensus       305 ~l~~li~~cl~~dp~~RPs~~el~~~l~~~~~  336 (338)
T cd05102         305 EIYRIMLACWQGDPKERPTFSALVEILGDLLQ  336 (338)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHHHh
Confidence            46678899999999999999999999998764


No 7  
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=94.68  E-value=0.054  Score=40.70  Aligned_cols=33  Identities=24%  Similarity=0.502  Sum_probs=29.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ..+..+...|++.+|.+||++.+++..|+.+..
T Consensus       256 ~~~~~~i~~cl~~~P~~Rp~~~~i~~~l~~~~~  288 (290)
T cd05045         256 EEMYNLMLTCWKQEPDKRPTFADISKELEKMMV  288 (290)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHHHHHHHHHh
Confidence            456778899999999999999999999998753


No 8  
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=94.67  E-value=0.046  Score=40.98  Aligned_cols=33  Identities=24%  Similarity=0.493  Sum_probs=29.1

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ...+..+..+|+..+|.+||++.+++..|+.+.
T Consensus       260 ~~~~~~li~~~l~~~p~~Rps~~eil~~l~~~~  292 (293)
T cd05053         260 TQELYHLMRDCWHEVPSQRPTFKQLVEDLDRML  292 (293)
T ss_pred             CHHHHHHHHHHcccCcccCcCHHHHHHHHHHhh
Confidence            346778999999999999999999999998764


No 9  
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=94.58  E-value=0.053  Score=40.03  Aligned_cols=31  Identities=19%  Similarity=0.367  Sum_probs=27.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|+..+|.+||+|.+|+..|+.+
T Consensus       237 ~~~~~li~~c~~~~p~~Rp~~~~i~~~l~~~  267 (268)
T cd05063         237 SAVYQLMLQCWQQDRARRPRFVDIVNLLDKL  267 (268)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHhh
Confidence            4567899999999999999999999999865


No 10 
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=94.32  E-value=0.062  Score=40.45  Aligned_cols=33  Identities=12%  Similarity=0.246  Sum_probs=29.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ..+.++..+|++.+|.+||++.+|+..|+.+..
T Consensus       252 ~~~~~li~~~l~~~P~~Rpt~~~v~~~l~~~~~  284 (291)
T cd05094         252 KEVYDIMLGCWQREPQQRLNIKEIYKILHALGK  284 (291)
T ss_pred             HHHHHHHHHHcccChhhCcCHHHHHHHHHHHHh
Confidence            456788999999999999999999999998865


No 11 
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=94.32  E-value=0.054  Score=40.41  Aligned_cols=31  Identities=19%  Similarity=0.460  Sum_probs=27.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|+..+|..||++.+|+..|+.+
T Consensus       253 ~~~~~li~~cl~~~p~~Rpt~~ei~~~l~~~  283 (284)
T cd05081         253 AEIYAIMKECWNNDPSQRPSFSELALQVEAI  283 (284)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHHHHHHhc
Confidence            3577888999999999999999999999864


No 12 
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=94.29  E-value=0.062  Score=41.84  Aligned_cols=33  Identities=27%  Similarity=0.414  Sum_probs=29.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ..+..+..+|++.+|.+||++.+++..|+.+++
T Consensus       303 ~~~~~l~~~cl~~~p~~RPs~~ell~~l~~~~~  335 (337)
T cd05054         303 PEIYSIMLDCWHNNPEDRPTFSELVEILGDLLQ  335 (337)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHHHHHh
Confidence            457788899999999999999999999998765


No 13 
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=94.19  E-value=0.069  Score=39.44  Aligned_cols=31  Identities=19%  Similarity=0.489  Sum_probs=27.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|++.+|.+||++.+|+..|+.+
T Consensus       235 ~~l~~li~~cl~~~p~~Rp~~~ei~~~l~~~  265 (266)
T cd05033         235 SALYQLMLDCWQKDRNERPTFSQIVSTLDKM  265 (266)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHhh
Confidence            4567888999999999999999999999864


No 14 
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=94.18  E-value=0.055  Score=40.81  Aligned_cols=29  Identities=24%  Similarity=0.402  Sum_probs=26.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|.+||+|.+|++.|+
T Consensus       266 ~~l~~li~~~l~~~p~~RPs~~~i~~~l~  294 (295)
T cd05097         266 SPVFKLMMRCWSRDIKDRPTFNKIHHFLR  294 (295)
T ss_pred             HHHHHHHHHHcCCCchhCcCHHHHHHHHh
Confidence            45778899999999999999999999885


No 15 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=94.17  E-value=0.056  Score=39.80  Aligned_cols=31  Identities=39%  Similarity=0.766  Sum_probs=27.4

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      -..+..++.+|++.+|.+||++.++++.|+.
T Consensus       230 ~~~~~~li~~~l~~~P~~Rp~~~~l~~~l~~  260 (261)
T cd05068         230 PKELYDIMLDCWKEDPDDRPTFETLQWKLED  260 (261)
T ss_pred             CHHHHHHHHHHhhcCcccCCCHHHHHHHHhc
Confidence            3567778899999999999999999999974


No 16 
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=94.12  E-value=0.076  Score=39.21  Aligned_cols=31  Identities=23%  Similarity=0.414  Sum_probs=26.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|+..+|.+||++.++++.|+.+
T Consensus       232 ~~~~~li~~cl~~~p~~Rp~~~~l~~~l~~~  262 (263)
T cd05052         232 PKVYELMRACWQWNPSDRPSFAEIHQAFETM  262 (263)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHHHHHHhh
Confidence            3466678899999999999999999999864


No 17 
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=94.10  E-value=0.059  Score=39.57  Aligned_cols=30  Identities=20%  Similarity=0.492  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|+..+|.+||++.+++..|+.
T Consensus       231 ~~~~~~i~~~l~~~p~~Rpt~~~l~~~L~~  260 (261)
T cd05148         231 QEIYKIMLECWAAEPEDRPSFKALREELDN  260 (261)
T ss_pred             HHHHHHHHHHcCCCchhCcCHHHHHHHHhc
Confidence            456778899999999999999999999975


No 18 
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=94.10  E-value=0.065  Score=39.82  Aligned_cols=32  Identities=25%  Similarity=0.527  Sum_probs=28.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+.++..+|+..+|..||++.+++..|..++
T Consensus       238 ~~~~~li~~~l~~~p~~Rps~~~il~~l~~~~  269 (270)
T cd05047         238 DEVYDLMRQCWREKPYERPSFAQILVSLNRML  269 (270)
T ss_pred             HHHHHHHHHHcccChhhCCCHHHHHHHHHHhh
Confidence            45678899999999999999999999998765


No 19 
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=94.02  E-value=0.068  Score=41.55  Aligned_cols=32  Identities=22%  Similarity=0.394  Sum_probs=28.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .+..+...|++.+|.+||++.++++.|+.+.+
T Consensus       310 ~~~~~~~~cl~~~p~~Rps~~eil~~l~~~~~  341 (343)
T cd05103         310 EMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQ  341 (343)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHHHh
Confidence            46778889999999999999999999998765


No 20 
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=94.02  E-value=0.059  Score=40.39  Aligned_cols=29  Identities=34%  Similarity=0.676  Sum_probs=26.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|.+||++.++++.|+
T Consensus       267 ~~l~~li~~cl~~~p~~Rpt~~el~~~L~  295 (296)
T cd05051         267 KDIYELMLECWRRDEEDRPTFREIHLFLQ  295 (296)
T ss_pred             HHHHHHHHHHhccChhcCCCHHHHHHHhc
Confidence            46788999999999999999999998875


No 21 
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=93.94  E-value=0.066  Score=39.19  Aligned_cols=28  Identities=29%  Similarity=0.610  Sum_probs=25.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..++.+|++.+|.+||++.+|++.|
T Consensus       228 ~~~~~l~~~~l~~~p~~Rp~~~~~l~~l  255 (256)
T cd05112         228 QSVYELMQHCWKERPEDRPSFSLLLHQL  255 (256)
T ss_pred             HHHHHHHHHHcccChhhCCCHHHHHHhh
Confidence            4467789999999999999999999876


No 22 
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=93.94  E-value=0.077  Score=39.04  Aligned_cols=32  Identities=31%  Similarity=0.472  Sum_probs=28.0

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ...+.++..+|++.+|.+||++.+|+..|+.+
T Consensus       241 ~~~~~~li~~~l~~~p~~Rp~~~e~~~~l~~~  272 (273)
T cd05035         241 LDELYDLMYSCWRADPKDRPTFTKLREVLENI  272 (273)
T ss_pred             CHHHHHHHHHHcCCChhhCcCHHHHHHHHHhh
Confidence            35677888899999999999999999999864


No 23 
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=93.87  E-value=0.074  Score=39.26  Aligned_cols=31  Identities=23%  Similarity=0.405  Sum_probs=27.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|++.+|.+||++.+++..|+.+
T Consensus       241 ~~~~~li~~~l~~~p~~Rps~~~l~~~l~~~  271 (272)
T cd05075         241 DGLYSLMSSCWLLNPKDRPSFETLRCELEKA  271 (272)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHhh
Confidence            4567888999999999999999999999864


No 24 
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=93.81  E-value=0.093  Score=38.52  Aligned_cols=32  Identities=19%  Similarity=0.381  Sum_probs=28.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+..+...|+..+|.+||++.+|+..|+.+.
T Consensus       229 ~~~~~li~~cl~~~p~~Rp~~~~il~~l~~~~  260 (262)
T cd05058         229 DPLYEVMLSCWHPKPEMRPTFSELVSRIEQIF  260 (262)
T ss_pred             HHHHHHHHHHcCCChhhCCCHHHHHHHHHHHh
Confidence            35667889999999999999999999998765


No 25 
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=93.79  E-value=0.11  Score=39.38  Aligned_cols=35  Identities=23%  Similarity=0.441  Sum_probs=30.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      ..+..+..+|+..+|..||+|.+|+..|+.+....
T Consensus       269 ~~~~~li~~~l~~~p~~Rps~~evl~~l~~~~~~~  303 (307)
T cd05098         269 NELYMMMRDCWHAVPSQRPTFKQLVEDLDRILALT  303 (307)
T ss_pred             HHHHHHHHHHcccChhhCcCHHHHHHHHHHHHHHh
Confidence            45566788999999999999999999999988764


No 26 
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=93.75  E-value=0.078  Score=39.69  Aligned_cols=29  Identities=17%  Similarity=0.314  Sum_probs=26.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|.+||++.++++.|+
T Consensus       259 ~~l~~li~~~l~~~p~~Rpt~~el~~~l~  287 (288)
T cd05050         259 LELYNLMRLCWSKLPSDRPSFASINRILQ  287 (288)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhh
Confidence            45777889999999999999999999986


No 27 
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=93.73  E-value=0.064  Score=39.93  Aligned_cols=30  Identities=20%  Similarity=0.338  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+.++..+|+..+|.+||++.+|+..|+.
T Consensus       253 ~~~~~l~~~c~~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05048         253 ARVYALMIECWNEIPARRPRFKDIHTRLRS  282 (283)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHhc
Confidence            456778899999999999999999999874


No 28 
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=93.70  E-value=0.098  Score=39.14  Aligned_cols=31  Identities=16%  Similarity=0.325  Sum_probs=28.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|++.+|.+||++.+++..|+.+
T Consensus       253 ~~~~~li~~~l~~~p~~Rpt~~~il~~l~~~  283 (284)
T cd05079         253 EEVYQLMRKCWEFQPSKRTTFQNLIEGFEAI  283 (284)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHHHHhh
Confidence            4677889999999999999999999999865


No 29 
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=93.66  E-value=0.1  Score=39.16  Aligned_cols=34  Identities=9%  Similarity=0.206  Sum_probs=29.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQL   60 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~   60 (127)
                      ..+.++..+|++.+|.+||++.+|...|+.+...
T Consensus       249 ~~l~~li~~~l~~~p~~Rpt~~~v~~~l~~~~~~  282 (288)
T cd05093         249 KEVYDLMLGCWQREPHMRLNIKEIHSLLQNLAKA  282 (288)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHHHHHHHHHHh
Confidence            3577888999999999999999999999887754


No 30 
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=93.58  E-value=0.11  Score=38.57  Aligned_cols=32  Identities=16%  Similarity=0.282  Sum_probs=28.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .+.++..+|+..+|..||++.+|+..|+.+..
T Consensus       247 ~~~~li~~~l~~~p~~Rps~~~~~~~l~~~~~  278 (280)
T cd05043         247 ELFAVMACCWALDPEERPSFSQLVQCLTDFHA  278 (280)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHHHHHHHHHh
Confidence            46778899999999999999999999987653


No 31 
>PHA02988 hypothetical protein; Provisional
Probab=93.56  E-value=0.12  Score=39.06  Aligned_cols=32  Identities=25%  Similarity=0.523  Sum_probs=27.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+.++..+|++.+|.+||++.+++..|+...
T Consensus       249 ~~l~~li~~cl~~dp~~Rps~~ell~~l~~~~  280 (283)
T PHA02988        249 LEIKCIVEACTSHDSIKRPNIKEILYNLSLYK  280 (283)
T ss_pred             HHHHHHHHHHhcCCcccCcCHHHHHHHHHHHH
Confidence            34566778999999999999999999998754


No 32 
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=93.51  E-value=0.066  Score=39.79  Aligned_cols=28  Identities=21%  Similarity=0.660  Sum_probs=21.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..+...|+..+|.+||++.++++.|
T Consensus       232 ~~~~~li~~C~~~~p~~RPs~~~i~~~L  259 (259)
T PF07714_consen  232 KDIYSLIQQCWSHDPEKRPSFQEILQEL  259 (259)
T ss_dssp             HHHHHHHHHHT-SSGGGS--HHHHHHHH
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHhcC
Confidence            4466788999999999999999999876


No 33 
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=93.39  E-value=0.095  Score=38.49  Aligned_cols=31  Identities=19%  Similarity=0.362  Sum_probs=27.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|+..+|.+||++.+++..|+.+
T Consensus       225 ~~l~~li~~cl~~~p~~Rp~~~~l~~~l~~~  255 (257)
T cd05060         225 QEIYSIMLSCWKYRPEDRPTFSELESTFRRD  255 (257)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHHHHHHhc
Confidence            4567888999999999999999999999864


No 34 
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=93.33  E-value=0.11  Score=39.09  Aligned_cols=29  Identities=17%  Similarity=0.465  Sum_probs=26.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|..||+|.+|+..|+
T Consensus       267 ~~~~~li~~cl~~~p~~Rp~~~~i~~~l~  295 (296)
T cd05095         267 DSLYKLMLSCWRRNAKERPSFQEIHATLL  295 (296)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            45678889999999999999999999886


No 35 
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=93.24  E-value=0.12  Score=38.19  Aligned_cols=32  Identities=22%  Similarity=0.365  Sum_probs=28.5

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ...+.++..+|+..+|..||++.++...|+.+
T Consensus       241 ~~~~~~l~~~~l~~~p~~Rps~~~~~~~l~~~  272 (273)
T cd05074         241 LEDVYELMCQCWSPEPKCRPSFQHLRDQLELI  272 (273)
T ss_pred             CHHHHHHHHHHcCCChhhCcCHHHHHHHHHhh
Confidence            35678899999999999999999999999864


No 36 
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=93.23  E-value=0.1  Score=38.24  Aligned_cols=27  Identities=26%  Similarity=0.535  Sum_probs=24.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      .+..+..+|+..+|..||++.+++..|
T Consensus       229 ~~~~li~~c~~~~p~~Rps~~~l~~~l  255 (256)
T cd05114         229 TVYEVMYSCWHEKPEGRPTFAELLRAI  255 (256)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHHhh
Confidence            467888999999999999999999876


No 37 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=93.16  E-value=0.082  Score=41.85  Aligned_cols=29  Identities=24%  Similarity=0.471  Sum_probs=26.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      .+..+..+|++.+|.+||++.+|+..|+.
T Consensus       345 ~l~~li~~cl~~dP~~RPs~~eil~~l~~  373 (375)
T cd05104         345 EMYDIMKSCWDADPLKRPTFKQIVQLIEQ  373 (375)
T ss_pred             HHHHHHHHHccCChhHCcCHHHHHHHHHh
Confidence            46678889999999999999999999985


No 38 
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=93.14  E-value=0.15  Score=38.51  Aligned_cols=36  Identities=19%  Similarity=0.422  Sum_probs=30.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhhh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQQ   62 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~~   62 (127)
                      ..+.++..+|++.+|..||++.+++..|+.+.....
T Consensus       245 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~~~~~~~~  280 (297)
T cd05089         245 DEVYELMRQCWRDRPYERPPFAQISVQLSRMLEARK  280 (297)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHHHHHhhc
Confidence            346678889999999999999999999998876554


No 39 
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=93.09  E-value=0.11  Score=37.95  Aligned_cols=29  Identities=24%  Similarity=0.472  Sum_probs=25.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|.+||++.+|.+.|+
T Consensus       223 ~~~~~li~~~l~~~p~~Rps~~~~~~~l~  251 (252)
T cd05084         223 DAVYRLMERCWEYDPGQRPSFSTVHQELQ  251 (252)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHh
Confidence            45677888999999999999999999885


No 40 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=93.07  E-value=0.11  Score=38.25  Aligned_cols=30  Identities=23%  Similarity=0.475  Sum_probs=26.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+.++..+|+..+|.+||++.++...|+.
T Consensus       231 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  260 (261)
T cd05072         231 DELYDIMKTCWKEKAEERPTFDYLQSVLDD  260 (261)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            346678889999999999999999999874


No 41 
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=92.89  E-value=0.13  Score=37.87  Aligned_cols=29  Identities=21%  Similarity=0.461  Sum_probs=24.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|..||++.+|...|+
T Consensus       240 ~~l~~li~~cl~~~p~~Rp~~~e~~~~~~  268 (269)
T cd08528         240 EDVTDVITSCLTPDAEARPDIIQVSAMIS  268 (269)
T ss_pred             HHHHHHHHHHCCCCCccCCCHHHHHHHhc
Confidence            34566777999999999999999998875


No 42 
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=92.89  E-value=0.15  Score=37.69  Aligned_cols=31  Identities=16%  Similarity=0.434  Sum_probs=26.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+..+..+|++.+|..||+|.+++..|..+
T Consensus       236 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~~~  266 (267)
T cd05066         236 AALHQLMLDCWQKDRNERPKFEQIVSILDKL  266 (267)
T ss_pred             HHHHHHHHHHcccCchhCCCHHHHHHHHHhh
Confidence            3456788899999999999999999998764


No 43 
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=92.86  E-value=0.13  Score=37.43  Aligned_cols=29  Identities=14%  Similarity=0.433  Sum_probs=26.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+++..|.
T Consensus       221 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~  249 (250)
T cd05085         221 DDVYKVMQRCWDYKPENRPKFSELQKELA  249 (250)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHhc
Confidence            56778899999999999999999998874


No 44 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=92.80  E-value=0.13  Score=38.89  Aligned_cols=29  Identities=24%  Similarity=0.433  Sum_probs=25.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|+..+|.+||++.+|...|+
T Consensus       275 ~~~~~li~~cl~~~p~~RPs~~~i~~~l~  303 (304)
T cd05096         275 QGLYELMLQCWSRDCRERPSFSDIHAFLT  303 (304)
T ss_pred             HHHHHHHHHHccCCchhCcCHHHHHHHHh
Confidence            45677889999999999999999988875


No 45 
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=92.71  E-value=0.15  Score=38.02  Aligned_cols=29  Identities=21%  Similarity=0.457  Sum_probs=25.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|++.+|.+||++.+|++.|.
T Consensus       248 ~~~~~~i~~cl~~~p~~Rps~~~vl~~l~  276 (277)
T cd05036         248 GPVYRIMTDCWQHTPEDRPNFATILERIQ  276 (277)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHhh
Confidence            35667888999999999999999999875


No 46 
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=92.67  E-value=0.19  Score=36.92  Aligned_cols=30  Identities=17%  Similarity=0.354  Sum_probs=25.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      .+..+..+|+..+|.+||+|.+|...++.+
T Consensus       236 ~~~~li~~~l~~~p~~Rpt~~~i~~~~~~~  265 (267)
T cd08229         236 ELRQLVNMCINPDPEKRPDITYVYDVAKRM  265 (267)
T ss_pred             HHHHHHHHhcCCCcccCCCHHHHHHHHhhh
Confidence            455677799999999999999999988764


No 47 
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=92.65  E-value=0.13  Score=37.87  Aligned_cols=28  Identities=29%  Similarity=0.547  Sum_probs=25.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..+..+|+..+|.+||++.+++..|
T Consensus       228 ~~~~~li~~cl~~~p~~Rpt~~~~l~~l  255 (256)
T cd05059         228 TEVYTIMYSCWHEKPEDRPAFKKLLSQL  255 (256)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHHHHh
Confidence            4577889999999999999999999876


No 48 
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=92.64  E-value=0.17  Score=37.26  Aligned_cols=31  Identities=26%  Similarity=0.373  Sum_probs=27.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|+..+|.+||++.+|+..|+.+
T Consensus       235 ~~~~~li~~cl~~~p~~Rp~~~~vl~~~~~~  265 (267)
T cd08228         235 EKLRELVSMCIYPDPDQRPDIGYVHQIAKQM  265 (267)
T ss_pred             HHHHHHHHHHCCCCcccCcCHHHHHHHHHHh
Confidence            4466777899999999999999999999864


No 49 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=92.61  E-value=0.15  Score=40.31  Aligned_cols=32  Identities=19%  Similarity=0.339  Sum_probs=27.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+..+..+|++.+|.+||++.+|++.|+.+.
T Consensus       342 ~~l~~li~~cl~~dp~~RPs~~~l~~~l~~~~  373 (374)
T cd05106         342 PEIYSIMKMCWNLEPTERPTFSQISQLIQRQL  373 (374)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHHHh
Confidence            34567778999999999999999999999864


No 50 
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=92.52  E-value=0.14  Score=38.21  Aligned_cols=30  Identities=20%  Similarity=0.271  Sum_probs=25.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+...|++.+|.+||++.+++..|+.
T Consensus       253 ~~~~~li~~cl~~~p~~RP~~~~i~~~l~~  282 (283)
T cd05091         253 AWVYTLMLECWNEFPSRRPRFKDIHSRLRT  282 (283)
T ss_pred             HHHHHHHHHHhCCCcccCCCHHHHHHHhhC
Confidence            346678889999999999999999998863


No 51 
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=92.50  E-value=0.17  Score=37.39  Aligned_cols=31  Identities=16%  Similarity=0.438  Sum_probs=26.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++...|++.+|.+||+|.+|+..|+.+
T Consensus       238 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~~~  268 (269)
T cd05065         238 TALHQLMLDCWQKDRNARPKFGQIVSTLDKM  268 (269)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHhh
Confidence            3467788899999999999999999988764


No 52 
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=92.45  E-value=0.1  Score=38.46  Aligned_cols=29  Identities=28%  Similarity=0.656  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|++.+|..||++.++++.|+
T Consensus       230 ~~~~~li~~~l~~~p~~Rps~~~il~~l~  258 (258)
T cd05078         230 TELANLINQCMDYEPDFRPSFRAIIRDLN  258 (258)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHHHhcC
Confidence            34677888999999999999999998763


No 53 
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=92.36  E-value=0.15  Score=37.86  Aligned_cols=29  Identities=14%  Similarity=0.385  Sum_probs=25.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|++.+|.+||++.+++..|+
T Consensus       248 ~~~~~li~~~l~~~p~~Rps~~e~l~~l~  276 (277)
T cd05062         248 DMLFELMRMCWQYNPKMRPSFLEIISSIK  276 (277)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHhh
Confidence            35677889999999999999999998875


No 54 
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=92.30  E-value=0.14  Score=37.69  Aligned_cols=29  Identities=31%  Similarity=0.596  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|.+||++.+++..|+
T Consensus       228 ~~~~~li~~cl~~~p~~Rp~~~~ll~~~~  256 (256)
T cd05113         228 EKVYAIMYSCWHEKAEERPTFQQLLSSIE  256 (256)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHhhC
Confidence            45677888999999999999999998764


No 55 
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=92.24  E-value=0.23  Score=36.75  Aligned_cols=33  Identities=21%  Similarity=0.352  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ....+.++..+|++.+|.+||++.++...|+..
T Consensus       228 ~~~~l~~li~~~l~~~p~~Rp~~~~~~~~l~~~  260 (262)
T cd05071         228 CPESLHDLMCQCWRKEPEERPTFEYLQAFLEDY  260 (262)
T ss_pred             cCHHHHHHHHHHccCCcccCCCHHHHHHHHHHh
Confidence            345678899999999999999999999999864


No 56 
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=92.20  E-value=0.15  Score=37.46  Aligned_cols=30  Identities=20%  Similarity=0.360  Sum_probs=26.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|++.+|.+||++.+++..|+.
T Consensus       226 ~~~~~li~~~l~~~p~~Rpt~~~l~~~l~~  255 (256)
T cd05082         226 PVVYDVMKQCWHLDAATRPSFLQLREQLEH  255 (256)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHHHHHhc
Confidence            345677889999999999999999998874


No 57 
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=92.20  E-value=0.26  Score=37.57  Aligned_cols=33  Identities=18%  Similarity=0.391  Sum_probs=28.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ..+..+..+|+..+|..||++.+++..|..+..
T Consensus       263 ~~l~~li~~cl~~~p~~Rps~~~ll~~l~~~~~  295 (314)
T cd05099         263 HELYMLMRECWHAVPTQRPTFKQLVEALDKVLA  295 (314)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHHHHHHHHHH
Confidence            355678889999999999999999999987654


No 58 
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=92.20  E-value=0.27  Score=36.77  Aligned_cols=32  Identities=19%  Similarity=0.323  Sum_probs=27.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .+..+..+|+..+|..||++.+++..|..+..
T Consensus       239 ~~~~li~~c~~~~p~~Rps~~el~~~l~~~~~  270 (279)
T cd05111         239 DVYMVMVKCWMIDENVRPTFKELANEFTRMAR  270 (279)
T ss_pred             HHHHHHHHHcCCCcccCcCHHHHHHHHHHHHh
Confidence            45567789999999999999999999887664


No 59 
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=92.16  E-value=0.16  Score=37.24  Aligned_cols=30  Identities=20%  Similarity=0.395  Sum_probs=26.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|+..+|.+||++.+++..|..
T Consensus       226 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  255 (256)
T cd05039         226 PEVYKVMKDCWELDPAKRPTFKQLREQLAL  255 (256)
T ss_pred             HHHHHHHHHHhccChhhCcCHHHHHHHHhc
Confidence            446678889999999999999999999864


No 60 
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=92.11  E-value=0.23  Score=37.73  Aligned_cols=34  Identities=24%  Similarity=0.503  Sum_probs=29.1

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      .+..+..+|+..+|..||++.+++..|+.+..-.
T Consensus       251 ~~~~li~~~l~~~p~~Rp~~~~il~~l~~~~~~~  284 (303)
T cd05088         251 EVYDLMRQCWREKPYERPSFAQILVSLNRMLEER  284 (303)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHHHHhh
Confidence            4567888999999999999999999998776543


No 61 
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=92.09  E-value=0.24  Score=38.16  Aligned_cols=36  Identities=22%  Similarity=0.444  Sum_probs=30.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhhh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQQ   62 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~~   62 (127)
                      ..+..+..+|++.+|..||++.+++..|+.+.....
T Consensus       263 ~~l~~li~~cl~~~p~~Rps~~ell~~l~~~~~~~~  298 (334)
T cd05100         263 HELYMIMRECWHAVPSQRPTFKQLVEDLDRVLTVTS  298 (334)
T ss_pred             HHHHHHHHHHcccChhhCcCHHHHHHHHHHHhhhcC
Confidence            456778899999999999999999999998876543


No 62 
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=91.99  E-value=0.23  Score=37.79  Aligned_cols=31  Identities=19%  Similarity=0.374  Sum_probs=27.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|+..+|.+||++.+++..|+.+
T Consensus       271 ~~~~~li~~cl~~~p~~Rpt~~ell~~l~~~  301 (302)
T cd05055         271 AEIYDIMKTCWDADPLKRPTFKQIVQLIGKQ  301 (302)
T ss_pred             HHHHHHHHHHcCCCchhCcCHHHHHHHHHhh
Confidence            3567788899999999999999999999864


No 63 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=91.85  E-value=0.25  Score=36.40  Aligned_cols=30  Identities=30%  Similarity=0.492  Sum_probs=25.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|++.+|.+||++.+|+..|+.
T Consensus       230 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~~  259 (260)
T cd05069         230 ESLHELMKLCWKKDPDERPTFEYIQSFLED  259 (260)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            446667789999999999999999998874


No 64 
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=91.84  E-value=0.25  Score=36.34  Aligned_cols=29  Identities=24%  Similarity=0.453  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+|.+.|+
T Consensus       240 ~~~~~li~~~l~~~p~~Rp~~~~i~~~l~  268 (269)
T cd05044         240 DKIYQLMTNCWAQDPSERPTFDRIQEILQ  268 (269)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHHh
Confidence            34567888999999999999999999885


No 65 
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=91.63  E-value=0.31  Score=35.66  Aligned_cols=30  Identities=20%  Similarity=0.464  Sum_probs=26.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      .+..+..+|+..+|..||++.+++..|..+
T Consensus       236 ~~~~~i~~cl~~~p~~Rp~~~~il~~~~~~  265 (267)
T cd08224         236 ELRDLVSRCINPDPEKRPDISYVLQVAKEM  265 (267)
T ss_pred             HHHHHHHHHcCCCcccCCCHHHHHHHHHHh
Confidence            566788899999999999999999999865


No 66 
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=91.63  E-value=0.19  Score=37.69  Aligned_cols=27  Identities=33%  Similarity=0.717  Sum_probs=24.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      .+..+..+|++.+|.+||++.+|++.|
T Consensus       247 ~~~~li~~cl~~~p~~Rps~~~il~~L  273 (274)
T cd05076         247 ELATLISQCLTYEPTQRPSFRTILRDL  273 (274)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHHhh
Confidence            467788899999999999999999877


No 67 
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=91.62  E-value=0.22  Score=36.57  Aligned_cols=30  Identities=20%  Similarity=0.308  Sum_probs=25.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|++.+|.+||++.+|+..|+.
T Consensus       225 ~~l~~li~~~~~~~p~~Rp~~~~i~~~l~~  254 (257)
T cd05116         225 PEMYDLMKLCWTYGVDERPGFAVVELRLRN  254 (257)
T ss_pred             HHHHHHHHHHhccCchhCcCHHHHHHHHhc
Confidence            345567889999999999999999999874


No 68 
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=91.51  E-value=0.26  Score=36.48  Aligned_cols=29  Identities=21%  Similarity=0.399  Sum_probs=25.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|..||++.+|+..|+
T Consensus       251 ~~~~~li~~~l~~~p~~Rp~~~eil~~l~  279 (280)
T cd05049         251 SEVYDIMLGCWKRDPQQRINIKDIHERLQ  279 (280)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHhh
Confidence            45677888999999999999999999885


No 69 
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=91.49  E-value=0.26  Score=36.22  Aligned_cols=30  Identities=27%  Similarity=0.420  Sum_probs=26.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|+..+|.+||++.++...|+.
T Consensus       230 ~~~~~li~~~l~~~p~~Rpt~~~l~~~l~~  259 (260)
T cd05070         230 ISLHELMLQCWKKDPEERPTFEYLQSFLED  259 (260)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHHHHhc
Confidence            456778899999999999999999988864


No 70 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=91.45  E-value=0.24  Score=37.20  Aligned_cols=32  Identities=19%  Similarity=0.360  Sum_probs=27.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+..+..+|++.+|..||++.++++.|+...
T Consensus       248 ~~~~~li~~~l~~~p~~Rps~~~ll~~l~~~~  279 (288)
T cd05061         248 ERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDL  279 (288)
T ss_pred             HHHHHHHHHHcCCChhHCcCHHHHHHHHHhhc
Confidence            45677888999999999999999999888754


No 71 
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=91.23  E-value=0.24  Score=39.92  Aligned_cols=32  Identities=25%  Similarity=0.365  Sum_probs=28.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+.++..+|+..+|..||++.+++..|+.+.
T Consensus       369 ~~l~~li~~cl~~~P~~RPs~~ell~~L~~~~  400 (401)
T cd05107         369 DEIYEIMQKCWEEKFEIRPDFSQLVHLVGDLL  400 (401)
T ss_pred             HHHHHHHHHHcCCChhHCcCHHHHHHHHHHHh
Confidence            45667888999999999999999999998764


No 72 
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=91.20  E-value=0.31  Score=36.07  Aligned_cols=31  Identities=13%  Similarity=0.311  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++...|++.+|..||++.++...|..+
T Consensus       235 ~~~~~li~~c~~~~p~~RP~~~~i~~~l~~~  265 (266)
T cd05064         235 NLLHQLMLDCWQKERGERPRFSQIHSILSKM  265 (266)
T ss_pred             HHHHHHHHHHcCCCchhCCCHHHHHHHHHhh
Confidence            4566788899999999999999999988754


No 73 
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=90.88  E-value=0.27  Score=35.77  Aligned_cols=29  Identities=17%  Similarity=0.494  Sum_probs=25.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+++..|.
T Consensus       222 ~~~~~li~~~l~~~p~~Rp~~~ell~~l~  250 (251)
T cd05041         222 EEIYRLMLQCWAYDPENRPSFSEIYNELQ  250 (251)
T ss_pred             HHHHHHHHHHhccChhhCcCHHHHHHHhh
Confidence            45777888999999999999999998875


No 74 
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=90.57  E-value=0.31  Score=36.00  Aligned_cols=30  Identities=23%  Similarity=0.423  Sum_probs=26.3

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      -..+..+..+|++.+|.+||++.+++..|+
T Consensus       247 ~~~~~~li~~~l~~~p~~Rpt~~~l~~~l~  276 (277)
T cd05032         247 PDKLLELMRMCWQYNPKMRPTFLEIVSSLK  276 (277)
T ss_pred             CHHHHHHHHHHcCCChhhCCCHHHHHHHhc
Confidence            355678889999999999999999998875


No 75 
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=90.56  E-value=0.37  Score=35.17  Aligned_cols=29  Identities=21%  Similarity=0.326  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+++..|.
T Consensus       228 ~~~~~li~~~l~~~p~~Rps~~~~~~~l~  256 (257)
T cd05040         228 QDIYNVMLQCWAHNPADRPTFAALREFLP  256 (257)
T ss_pred             HHHHHHHHHHCCCCcccCCCHHHHHHHhc
Confidence            45667888999999999999999998874


No 76 
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=90.56  E-value=0.42  Score=36.24  Aligned_cols=32  Identities=19%  Similarity=0.336  Sum_probs=27.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+..+...|+..+|..||++.+++..|..+.
T Consensus       238 ~~~~~li~~c~~~~p~~Rp~~~~l~~~l~~~~  269 (303)
T cd05110         238 IDVYMVMVKCWMIDADSRPKFKELAAEFSRMA  269 (303)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHHHH
Confidence            45677888999999999999999999988764


No 77 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=90.51  E-value=0.38  Score=36.69  Aligned_cols=34  Identities=24%  Similarity=0.374  Sum_probs=29.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQL   60 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~   60 (127)
                      ..+..+..+|+..+|..||++.+++..|..+..-
T Consensus       238 ~~~~~li~~cl~~~p~~Rps~~~l~~~l~~~~~~  271 (316)
T cd05108         238 IDVYMIMVKCWMIDADSRPKFRELIIEFSKMARD  271 (316)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHHHHHHHHcC
Confidence            4567788999999999999999999998877543


No 78 
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=90.50  E-value=0.26  Score=39.70  Aligned_cols=32  Identities=22%  Similarity=0.357  Sum_probs=28.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      ..+.++..+|+..+|..||++.+|++.|+.+.
T Consensus       367 ~~l~~li~~cl~~dP~~RPt~~~l~~~l~~l~  398 (400)
T cd05105         367 QEVYDIMVKCWNSEPEKRPSFLHLSDIVESLL  398 (400)
T ss_pred             HHHHHHHHHHCccCHhHCcCHHHHHHHHHHHc
Confidence            45678889999999999999999999998754


No 79 
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=90.47  E-value=0.28  Score=35.48  Aligned_cols=29  Identities=31%  Similarity=0.566  Sum_probs=25.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+++..|+
T Consensus       234 ~~~~~li~~~l~~~p~~Rps~~~l~~~l~  262 (262)
T cd00192         234 DELYELMLSCWQLDPEDRPTFSELVERLE  262 (262)
T ss_pred             hHHHHHHHHHccCCcccCcCHHHHHHhhC
Confidence            45667888999999999999999998773


No 80 
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=90.45  E-value=0.44  Score=35.15  Aligned_cols=32  Identities=25%  Similarity=0.391  Sum_probs=27.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .+..+..+|+..+|..||++.+++..|+.+..
T Consensus       236 ~~~~li~~~l~~~P~~Rpt~~~~~~~l~~~~~  267 (270)
T cd05056         236 TLYSLMTKCWAYDPSKRPRFTELKAQLSDILQ  267 (270)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHHHHHh
Confidence            45667789999999999999999999998764


No 81 
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=90.43  E-value=0.35  Score=35.50  Aligned_cols=30  Identities=27%  Similarity=0.434  Sum_probs=26.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|+..+|.+||++.++...|+.
T Consensus       230 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~~  259 (260)
T cd05067         230 EELYELMRLCWKEKPEERPTFEYLRSVLED  259 (260)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHHHHhhc
Confidence            357778889999999999999999998874


No 82 
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=90.30  E-value=0.25  Score=36.03  Aligned_cols=28  Identities=32%  Similarity=0.665  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..+..+|+..+|.+||++.+|+..|
T Consensus       231 ~~~~~li~~~l~~~p~~Rpt~~~il~~l  258 (259)
T cd05037         231 AELANLINQCWTYDPTKRPSFRAILRDL  258 (259)
T ss_pred             hHHHHHHHHHhccChhhCCCHHHHHHhc
Confidence            5677888999999999999999999876


No 83 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=90.21  E-value=0.42  Score=35.52  Aligned_cols=34  Identities=21%  Similarity=0.274  Sum_probs=28.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHh
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQL   60 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~   60 (127)
                      ..+..+..+|+..+|..||++.+++..|+.+...
T Consensus       238 ~~~~~li~~~l~~dp~~Rp~~~~l~~~l~~~~~~  271 (279)
T cd05109         238 IDVYMIMVKCWMIDSECRPRFRELVDEFSRMARD  271 (279)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHHHhhcC
Confidence            4566788899999999999999999988776543


No 84 
>smart00750 KIND kinase non-catalytic C-lobe domain. It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Probab=90.21  E-value=0.48  Score=32.74  Aligned_cols=31  Identities=16%  Similarity=0.203  Sum_probs=27.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      .+.++..+|+..+|..||++.+++..+....
T Consensus       140 ~~~~~i~~cl~~~p~~Rp~~~~ll~~~~~~~  170 (176)
T smart00750      140 SFADFMRVCASRLPQRREAANHYLAHCRALF  170 (176)
T ss_pred             hHHHHHHHHHhcccccccCHHHHHHHHHHHH
Confidence            4788889999999999999999999887653


No 85 
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=90.16  E-value=0.34  Score=35.46  Aligned_cols=29  Identities=17%  Similarity=0.359  Sum_probs=25.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+.++..+|++.+|..||++.+++..|+
T Consensus       224 ~~~~~li~~~l~~~p~~Rp~~~~l~~~l~  252 (254)
T cd05083         224 ADVYVLMTSCWETEPKKRPSFHKLREKLE  252 (254)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHc
Confidence            44667888999999999999999999876


No 86 
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=89.80  E-value=0.44  Score=35.47  Aligned_cols=29  Identities=21%  Similarity=0.485  Sum_probs=24.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|..||++.++.+.|.
T Consensus       253 ~~~~~li~~cl~~~p~~Rp~~~~i~~~l~  281 (283)
T cd05090         253 PRMYSLMTECWQEGPSRRPRFKDIHTRLR  281 (283)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHHHhh
Confidence            34566778999999999999999998876


No 87 
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=89.69  E-value=0.48  Score=34.83  Aligned_cols=30  Identities=20%  Similarity=0.417  Sum_probs=25.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|++.+|.+||++.++...|+.
T Consensus       230 ~~~~~~i~~~l~~~p~~Rp~~~~l~~~L~~  259 (260)
T cd05073         230 EELYNIMMRCWKNRPEERPTFEYIQSVLDD  259 (260)
T ss_pred             HHHHHHHHHHcccCcccCcCHHHHHHHHhc
Confidence            346677789999999999999999998864


No 88 
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=89.62  E-value=0.48  Score=34.67  Aligned_cols=30  Identities=23%  Similarity=0.404  Sum_probs=26.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+.++..+|+..+|..||++.++...|+.
T Consensus       231 ~~~~~~i~~~l~~~p~~Rp~~~~l~~~l~~  260 (261)
T cd05034         231 EELYDLMLQCWDKDPEERPTFEYLQSFLED  260 (261)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHHHHHhc
Confidence            356778889999999999999999988864


No 89 
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=89.41  E-value=0.45  Score=35.52  Aligned_cols=29  Identities=17%  Similarity=0.383  Sum_probs=25.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|.+||++.+|...|+
T Consensus       251 ~~~~~li~~cl~~~P~~Rp~~~~l~~~l~  279 (280)
T cd05092         251 PEVYAIMQGCWQREPQQRMVIKDIHSRLQ  279 (280)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHHHHHh
Confidence            34567788999999999999999998875


No 90 
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=89.35  E-value=0.48  Score=34.94  Aligned_cols=31  Identities=16%  Similarity=0.244  Sum_probs=26.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++...|+..+|.+||++.+|.+.|+.+
T Consensus       225 ~~l~~li~~c~~~~~~~Rp~~~~i~~~l~~~  255 (257)
T cd05115         225 PEMYALMKDCWIYKWEDRPNFAKVEERMRTY  255 (257)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHHHhhh
Confidence            4556688899999999999999999998764


No 91 
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=88.90  E-value=0.41  Score=35.47  Aligned_cols=28  Identities=25%  Similarity=0.710  Sum_probs=24.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..+..+|++.+|.+||++.+++..|
T Consensus       234 ~~~~~li~~cl~~dp~~Rp~~~~il~~~  261 (262)
T cd05077         234 KELADLMTHCMNYDPNQRPFFRAIMRDI  261 (262)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHHHhc
Confidence            3456788899999999999999998865


No 92 
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=88.39  E-value=0.45  Score=34.46  Aligned_cols=28  Identities=29%  Similarity=0.522  Sum_probs=23.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+.++..+|+..+|..||++.+++..|
T Consensus       231 ~~~~~~i~~~l~~~p~~Rpt~~~ll~~l  258 (258)
T smart00219      231 PEIYKLMLQCWAEDPEDRPTFSELVEIL  258 (258)
T ss_pred             HHHHHHHHHHCcCChhhCcCHHHHHhhC
Confidence            4566788899999999999999998764


No 93 
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=87.63  E-value=0.96  Score=33.57  Aligned_cols=33  Identities=18%  Similarity=0.377  Sum_probs=28.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ..+..+..+|+..+|..||++.+++..|+.+.+
T Consensus       238 ~~~~~~~~~~l~~~p~~Rp~~~~l~~~l~~~~~  270 (279)
T cd05057         238 IDVYMVLVKCWMIDAESRPTFKELINEFSKMAR  270 (279)
T ss_pred             HHHHHHHHHHcCCChhhCCCHHHHHHHHHHHHh
Confidence            346677889999999999999999999998755


No 94 
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=87.56  E-value=0.63  Score=32.91  Aligned_cols=26  Identities=23%  Similarity=0.291  Sum_probs=23.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       215 ~~~~~~i~~~l~~~p~~Rp~~~~~~~  240 (244)
T smart00220      215 PEAKDLIRKLLVKDPEKRLTAEEALQ  240 (244)
T ss_pred             HHHHHHHHHHccCCchhccCHHHHhh
Confidence            56778899999999999999999985


No 95 
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=87.48  E-value=0.62  Score=33.78  Aligned_cols=26  Identities=27%  Similarity=0.502  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|.+||++.+|+.
T Consensus       236 ~~~~~l~~~~l~~~p~~Rp~~~~il~  261 (265)
T cd08217         236 SELNEVIKSMLNVDPDKRPSTEELLQ  261 (265)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHhh
Confidence            45667888999999999999999875


No 96 
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=86.84  E-value=0.82  Score=33.73  Aligned_cols=29  Identities=17%  Similarity=0.500  Sum_probs=25.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|+..+|..||+..+++..|.
T Consensus       246 ~~l~~~i~~~l~~~p~~Rp~~~~~l~~l~  274 (275)
T cd05046         246 SRLYKLMTRCWAVNPKDRPSFSELVSALG  274 (275)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHHHhc
Confidence            35677889999999999999999998874


No 97 
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=86.83  E-value=0.73  Score=33.44  Aligned_cols=27  Identities=26%  Similarity=0.604  Sum_probs=23.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.++++.
T Consensus       227 ~~~~~~i~~~l~~~p~~Rp~~~~ll~~  253 (256)
T cd08529         227 QQLAQLIDQCLTKDYRQRPDTFQLLRN  253 (256)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHhhC
Confidence            456778889999999999999998763


No 98 
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=86.45  E-value=0.67  Score=33.77  Aligned_cols=26  Identities=15%  Similarity=0.427  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|..||+|.+|+.
T Consensus       227 ~~~~~li~~~l~~~p~~Rp~~~~vl~  252 (256)
T cd08218         227 YDLRNLVSQLFKRNPRDRPSVNSILE  252 (256)
T ss_pred             HHHHHHHHHHhhCChhhCcCHHHHhh
Confidence            34667778999999999999999986


No 99 
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=86.07  E-value=0.87  Score=33.75  Aligned_cols=27  Identities=37%  Similarity=0.668  Sum_probs=23.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||+|.+|+..
T Consensus       227 ~~~~~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06642         227 KPFKEFVEACLNKDPRFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHHccCCcccCcCHHHHHHh
Confidence            446678889999999999999999873


No 100
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=85.40  E-value=0.71  Score=34.23  Aligned_cols=26  Identities=19%  Similarity=0.138  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|.+||++.+++.
T Consensus       254 ~~~~~li~~~l~~~P~~Rpt~~~il~  279 (283)
T cd07835         254 EDGLDLLSKMLVYDPAKRISAKAALQ  279 (283)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHhc
Confidence            34667888999999999999999874


No 101
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=85.03  E-value=1.1  Score=33.58  Aligned_cols=26  Identities=35%  Similarity=0.648  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+|+.
T Consensus       240 ~~~~~li~~~l~~~p~~Rpt~~eil~  265 (287)
T cd06621         240 EEFKDFIKQCLEKDPTRRPTPWDMLE  265 (287)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHHh
Confidence            34667889999999999999999876


No 102
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=84.81  E-value=0.89  Score=33.69  Aligned_cols=26  Identities=38%  Similarity=0.699  Sum_probs=22.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+++.
T Consensus       257 ~~~~~li~~~l~~~P~~Rp~~~~il~  282 (286)
T cd07846         257 GLVLDLAKQCLRIDPDDRPSSSQLLH  282 (286)
T ss_pred             HHHHHHHHHHhcCCcccchhHHHHhc
Confidence            34677888999999999999999875


No 103
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=84.49  E-value=0.86  Score=33.63  Aligned_cols=25  Identities=24%  Similarity=0.405  Sum_probs=19.8

Q ss_pred             HHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           30 AEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        30 ~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+-..|. .+|.+||++.+|++.|.
T Consensus       244 ~~l~~~c~-~~P~~Rpt~~~l~~~l~  268 (269)
T cd05087         244 YEVMQFCW-LQPEQRPSAEEVHLLLS  268 (269)
T ss_pred             HHHHHHHh-cCcccCCCHHHHHHHhc
Confidence            33445787 57999999999999875


No 104
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=84.41  E-value=1.2  Score=33.06  Aligned_cols=26  Identities=38%  Similarity=0.759  Sum_probs=22.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|++.+|.+||++.+++..
T Consensus       258 ~~~~li~~~l~~~p~~Rps~~ell~~  283 (286)
T cd06638         258 EFNDFIRKCLTKDYEKRPTVSDLLQH  283 (286)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhhc
Confidence            46677889999999999999999864


No 105
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=84.36  E-value=1.1  Score=32.64  Aligned_cols=26  Identities=19%  Similarity=0.488  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|.+||++.+++.
T Consensus       228 ~~~~~li~~~l~~~p~~Rp~~~~~l~  253 (257)
T cd08223         228 PELGELIATMLSKRPEKRPSVKSILR  253 (257)
T ss_pred             HHHHHHHHHHhccCcccCCCHHHHhc
Confidence            44677889999999999999999875


No 106
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=84.00  E-value=1.2  Score=31.96  Aligned_cols=26  Identities=35%  Similarity=0.632  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|+..+|..||++.+++.
T Consensus       231 ~~l~~~i~~~l~~~p~~Rp~~~~ll~  256 (260)
T cd06606         231 EEAKDFLRKCLRRDPKKRPTADELLQ  256 (260)
T ss_pred             HHHHHHHHHhCcCChhhCCCHHHHhh
Confidence            34566777999999999999999875


No 107
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=83.96  E-value=0.84  Score=33.79  Aligned_cols=26  Identities=27%  Similarity=0.424  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       259 ~~~~~li~~~l~~~p~~Rps~~~il~  284 (288)
T cd07833         259 SPALDFLKACLRMDPKERLTCDELLQ  284 (288)
T ss_pred             hHHHHHHHHHhccCchhcccHHHHhc
Confidence            45677888999999999999999874


No 108
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=83.94  E-value=0.89  Score=32.96  Aligned_cols=25  Identities=32%  Similarity=0.720  Sum_probs=21.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|..||++.+|+.
T Consensus       228 ~~~~~i~~~l~~~P~~Rps~~~il~  252 (256)
T cd06612         228 EFNDFVKKCLVKDPEERPSAIQLLQ  252 (256)
T ss_pred             HHHHHHHHHHhcChhhCcCHHHHhc
Confidence            4666778999999999999999875


No 109
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=83.63  E-value=1.2  Score=32.83  Aligned_cols=26  Identities=19%  Similarity=0.187  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       258 ~~~~~~i~~~l~~~P~~Rp~~~~~l~  283 (287)
T cd07840         258 PSALDLLDKLLTLDPKKRISADQALQ  283 (287)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHhh
Confidence            45678899999999999999999875


No 110
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=83.30  E-value=1.2  Score=32.78  Aligned_cols=26  Identities=27%  Similarity=0.291  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|.+||++.+++.
T Consensus       253 ~~~~~li~~~l~~~P~~R~~~~~~l~  278 (282)
T cd07831         253 AEGLDLLKKLLAYDPDERITAKQALR  278 (282)
T ss_pred             HHHHHHHHHHhccCcccccCHHHHhh
Confidence            56777888999999999999999875


No 111
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=83.11  E-value=1.4  Score=32.42  Aligned_cols=26  Identities=23%  Similarity=0.447  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       239 ~~~~~li~~~l~~~p~~Rpt~~~ll~  264 (268)
T cd06624         239 AEAKNFILRCFEPDPDKRASAHDLLQ  264 (268)
T ss_pred             HHHHHHHHHHcCCCchhCCCHHHHHh
Confidence            34566788999999999999999875


No 112
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=82.90  E-value=2.1  Score=32.84  Aligned_cols=29  Identities=28%  Similarity=0.543  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .-..+.++..+|+..+|..||++.+++..
T Consensus       280 ~~~~~~~li~~~l~~dP~~Rpta~e~l~~  308 (328)
T cd08226         280 FSPAFQNLVELCLQQDPEKRPSASSLLSH  308 (328)
T ss_pred             hhHHHHHHHHHHccCCcccCCCHHHHhhC
Confidence            34567788899999999999999999753


No 113
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=82.83  E-value=1.4  Score=32.38  Aligned_cols=26  Identities=19%  Similarity=0.179  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+...|++.+|.+||++.+++.
T Consensus       254 ~~~~~~i~~~l~~~P~~Rp~~~~ll~  279 (283)
T cd05118         254 PQALDLLSQMLHYDPHKRITAEQALA  279 (283)
T ss_pred             HHHHHHHHHHhccCcccCcCHHHHhh
Confidence            45678889999999999999999874


No 114
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=82.77  E-value=1.4  Score=32.57  Aligned_cols=26  Identities=27%  Similarity=0.353  Sum_probs=22.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|.+||++.+++.
T Consensus       254 ~~~~~li~~cl~~~p~~Rpt~~ei~~  279 (283)
T cd07830         254 PEAIDLIKDMLRWDPKKRPTASQALQ  279 (283)
T ss_pred             HHHHHHHHHhcccCcccCCCHHHHhh
Confidence            45778899999999999999999864


No 115
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=82.70  E-value=1.2  Score=33.14  Aligned_cols=30  Identities=20%  Similarity=0.440  Sum_probs=25.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+..+..+|+..+|..||++.+|+...-.
T Consensus       240 ~~~~~li~~~l~~dp~~Rpt~~e~~~~~~~  269 (284)
T cd06620         240 EDLRDFVDACLLKDPTERPTPQQLCAMPPF  269 (284)
T ss_pred             HHHHHHHHHHhcCCcccCcCHHHHhcCccc
Confidence            356678889999999999999999876544


No 116
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=82.57  E-value=1.2  Score=32.57  Aligned_cols=25  Identities=32%  Similarity=0.658  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       247 ~~~~li~~~l~~dp~~Rpt~~~ll~  271 (275)
T cd06608         247 KFNDFISECLIKNYEQRPFMEELLE  271 (275)
T ss_pred             HHHHHHHHHhhcChhhCcCHHHHhc
Confidence            4567788999999999999999875


No 117
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=82.47  E-value=1.3  Score=32.13  Aligned_cols=25  Identities=16%  Similarity=0.344  Sum_probs=21.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       228 ~l~~li~~~l~~~p~~Rpt~~~ll~  252 (256)
T cd08220         228 DLRQLILSMLNLDPSKRPQLSQIMA  252 (256)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHhh
Confidence            4567778999999999999999875


No 118
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=82.47  E-value=1.3  Score=32.19  Aligned_cols=25  Identities=16%  Similarity=0.409  Sum_probs=21.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       229 ~~~~~i~~~l~~~p~~Rpt~~~ll~  253 (257)
T cd08225         229 DLRSLISQLFKVSPRDRPSITSILK  253 (257)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHhh
Confidence            3556667899999999999999875


No 119
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=82.47  E-value=1.5  Score=32.56  Aligned_cols=29  Identities=31%  Similarity=0.555  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .-..+.++..+|++.+|..||++.+++..
T Consensus       225 ~~~~~~~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06640         225 FSKPFKEFIDACLNKDPSFRPTAKELLKH  253 (277)
T ss_pred             hhHHHHHHHHHHcccCcccCcCHHHHHhC
Confidence            34557788889999999999999999665


No 120
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=81.96  E-value=2  Score=33.54  Aligned_cols=31  Identities=23%  Similarity=0.430  Sum_probs=25.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      ..+.++..+|++.+|..||++.+++..+..+
T Consensus       270 e~l~~lik~mlqvdP~qRP~i~~ll~~~d~L  300 (302)
T KOG2345|consen  270 EALHQLIKSMLQVDPNQRPTIPELLSKLDDL  300 (302)
T ss_pred             HHHHHHHHHHhcCCcccCCCHHHHHHHHHhh
Confidence            4456677799999999999999999888754


No 121
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=81.91  E-value=1.5  Score=32.82  Aligned_cols=26  Identities=19%  Similarity=0.226  Sum_probs=22.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|+..+|..||++.+|+.
T Consensus       256 ~~~~~li~~~l~~~P~~R~s~~e~l~  281 (298)
T cd07841         256 DDALDLLQRLLTLNPNKRITARQALE  281 (298)
T ss_pred             HHHHHHHHHHhcCCcccCcCHHHHhh
Confidence            45677888999999999999999987


No 122
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=81.61  E-value=1.3  Score=30.30  Aligned_cols=27  Identities=22%  Similarity=0.544  Sum_probs=24.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+.++...|+..+|..||++.+++..
T Consensus       188 ~~~~~~l~~~l~~~p~~R~~~~~l~~~  214 (215)
T cd00180         188 PELKDLIRKMLQKDPEKRPSAKEILEH  214 (215)
T ss_pred             HHHHHHHHHHhhCCcccCcCHHHHhhC
Confidence            578889999999999999999998764


No 123
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=81.38  E-value=1.8  Score=31.95  Aligned_cols=25  Identities=24%  Similarity=0.288  Sum_probs=19.3

Q ss_pred             HHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           30 AEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        30 ~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      .++-..|. .+|.+||++.+|++.|-
T Consensus       243 ~~l~~~c~-~~P~~Rp~~~~i~~~l~  267 (268)
T cd05086         243 YEVLQFCW-LSPEKRATAEEVHRLLT  267 (268)
T ss_pred             HHHHHHHh-hCcccCCCHHHHHHHhc
Confidence            33445687 56999999999998774


No 124
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=81.23  E-value=1.6  Score=31.99  Aligned_cols=25  Identities=32%  Similarity=0.635  Sum_probs=21.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       244 ~~~~li~~~l~~~p~~Rpt~~~il~  268 (272)
T cd06637         244 KFQSFIESCLVKNHSQRPTTEQLMK  268 (272)
T ss_pred             HHHHHHHHHcCCChhhCCCHHHHhh
Confidence            4566778999999999999999864


No 125
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=81.14  E-value=1  Score=33.10  Aligned_cols=27  Identities=22%  Similarity=0.382  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+.++..+|+..+|..||++.+++..
T Consensus       239 ~~~~~li~~~l~~~P~~Rp~~~~il~~  265 (267)
T cd06646         239 STFHNFVKISLTKNPKKRPTAERLLTH  265 (267)
T ss_pred             HHHHHHHHHHhhCChhhCcCHHHHhcC
Confidence            345667789999999999999998764


No 126
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=81.08  E-value=1.5  Score=33.71  Aligned_cols=27  Identities=22%  Similarity=0.507  Sum_probs=22.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      .+.++..+|++.+|.+||++.+++...
T Consensus       276 ~l~~li~~~L~~~P~~Rpt~~ell~h~  302 (331)
T cd06649         276 DFQEFVNKCLIKNPAERADLKMLMNHT  302 (331)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhcCh
Confidence            456788899999999999999997643


No 127
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=80.90  E-value=1.3  Score=32.12  Aligned_cols=26  Identities=23%  Similarity=0.532  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++...|++.+|.+||++.+++.
T Consensus       231 ~~l~~li~~~l~~~p~~R~~~~~l~~  256 (260)
T PF00069_consen  231 EELRDLIKKMLSKDPEQRPSAEELLK  256 (260)
T ss_dssp             HHHHHHHHHHSSSSGGGSTTHHHHHT
T ss_pred             HHHHHHHHHHccCChhHCcCHHHHhc
Confidence            56777888999999999999999874


No 128
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=80.79  E-value=1.4  Score=33.50  Aligned_cols=28  Identities=18%  Similarity=0.540  Sum_probs=23.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      .+..+..+|+..+|.+||++.+|+...-
T Consensus       262 ~~~~li~~~l~~~P~~Rpt~~~ll~~~~  289 (308)
T cd06615         262 EFQDFVDKCLKKNPKERADLKELTKHPF  289 (308)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhcChh
Confidence            3667888999999999999999877643


No 129
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=80.56  E-value=1.5  Score=31.28  Aligned_cols=26  Identities=31%  Similarity=0.694  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+...|+..+|..||++.+++.
T Consensus       225 ~~~~~~i~~~l~~~p~~R~t~~~~l~  250 (253)
T cd05122         225 DEFKDFLKKCLQKNPEKRPTAEQLLK  250 (253)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHhc
Confidence            34666778999999999999999874


No 130
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=80.18  E-value=1.7  Score=32.01  Aligned_cols=25  Identities=28%  Similarity=0.694  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       226 ~~~~~l~~~l~~~p~~Rpt~~~il~  250 (274)
T cd06609         226 PFKDFVSLCLNKDPKERPSAKELLK  250 (274)
T ss_pred             HHHHHHHHHhhCChhhCcCHHHHhh
Confidence            4566778999999999999999976


No 131
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=80.06  E-value=1.6  Score=32.29  Aligned_cols=24  Identities=25%  Similarity=0.177  Sum_probs=20.4

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|+..+|.+||++.+|+.
T Consensus       258 ~~~li~~~l~~dP~~Rpt~~~ll~  281 (285)
T cd07861         258 GLDLLEKMLIYDPAKRISAKKALN  281 (285)
T ss_pred             HHHHHHHHhcCChhhCCCHHHHhc
Confidence            346777999999999999999864


No 132
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=79.91  E-value=1.7  Score=32.74  Aligned_cols=27  Identities=30%  Similarity=0.637  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|+..+|.+||++.+++..
T Consensus       269 ~~~~~li~~~l~~~P~~Rpt~~~ll~~  295 (314)
T cd08216         269 EHFHQFVELCLQRDPESRPSASQLLNH  295 (314)
T ss_pred             HHHHHHHHHHhhcCCCcCcCHHHHhcC
Confidence            346678889999999999999998763


No 133
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=79.76  E-value=2.1  Score=33.13  Aligned_cols=25  Identities=20%  Similarity=0.622  Sum_probs=21.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       274 ~~~~li~~~L~~~P~~Rpt~~ell~  298 (333)
T cd06650         274 EFQDFVNKCLIKNPAERADLKQLMV  298 (333)
T ss_pred             HHHHHHHHhccCCcccCcCHHHHhh
Confidence            3567888999999999999999965


No 134
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=79.70  E-value=1.8  Score=31.80  Aligned_cols=26  Identities=27%  Similarity=0.509  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+|+.
T Consensus       243 ~~~~~li~~~l~~~p~~Rps~~~il~  268 (272)
T cd06629         243 PVALDFLNACFTINPDNRPTARELLQ  268 (272)
T ss_pred             HHHHHHHHHHhcCChhhCCCHHHHhh
Confidence            45566777999999999999999875


No 135
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=79.60  E-value=1.8  Score=32.52  Aligned_cols=25  Identities=24%  Similarity=0.169  Sum_probs=21.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       288 ~~~~~i~~~l~~~P~~Rps~~eil~  312 (316)
T cd07842         288 QGFDLLRKLLEYDPTKRITAEEALE  312 (316)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhc
Confidence            4677888999999999999999874


No 136
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=79.50  E-value=1.6  Score=32.49  Aligned_cols=27  Identities=26%  Similarity=0.555  Sum_probs=22.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.+|+..
T Consensus       241 ~~l~~li~~~l~~~p~~Rpt~~~i~~~  267 (288)
T cd06616         241 PSFVNFINLCLIKDESKRPKYKELLEH  267 (288)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHhcC
Confidence            456777889999999999999998763


No 137
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=79.43  E-value=1.8  Score=31.51  Aligned_cols=27  Identities=26%  Similarity=0.463  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.+++..
T Consensus       227 ~~~~~~i~~~l~~~p~~R~s~~~ll~~  253 (256)
T cd08221         227 SELISLVHSLLQQDPEKRPTADEVLDQ  253 (256)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHhhC
Confidence            345667789999999999999998764


No 138
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=79.41  E-value=1.5  Score=32.68  Aligned_cols=26  Identities=31%  Similarity=0.604  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|..||++.+++.
T Consensus       261 ~~l~~li~~~l~~~p~~Rps~~~il~  286 (291)
T cd06639         261 RSFNHFISQCLIKDFEARPSVTHLLE  286 (291)
T ss_pred             HHHHHHHHHHhhcChhhCcCHHHHhc
Confidence            34667888999999999999999875


No 139
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=79.37  E-value=2.1  Score=31.65  Aligned_cols=24  Identities=17%  Similarity=0.180  Sum_probs=20.4

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|++.+|.+||++.+++.
T Consensus       257 ~~~li~~~l~~~P~~Rpt~~~~l~  280 (284)
T cd07860         257 GRDLLSQMLHYDPNKRISAKAALA  280 (284)
T ss_pred             HHHHHHHhcCCCcccCCCHHHHhc
Confidence            345778999999999999999874


No 140
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=79.20  E-value=2.2  Score=31.64  Aligned_cols=27  Identities=30%  Similarity=0.592  Sum_probs=23.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|..||++.+++..
T Consensus       227 ~~~~~~i~~~l~~~p~~Rp~~~~~l~~  253 (277)
T cd06641         227 KPLKEFVEACLNKEPSFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHhC
Confidence            346677889999999999999999884


No 141
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=79.01  E-value=2.1  Score=31.09  Aligned_cols=26  Identities=31%  Similarity=0.667  Sum_probs=22.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+++.
T Consensus       238 ~~~~~li~~~l~~~p~~Rp~~~~ll~  263 (267)
T cd06610         238 KSFRKMISLCLQKDPSKRPTAEELLK  263 (267)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHhh
Confidence            44567788999999999999999874


No 142
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=78.93  E-value=2.3  Score=30.96  Aligned_cols=25  Identities=28%  Similarity=0.670  Sum_probs=21.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       232 ~~~~li~~~l~~~p~~Rpt~~~ll~  256 (265)
T cd06605         232 DFQDFVNLCLIKDPRERPSYKELLE  256 (265)
T ss_pred             HHHHHHHHHcCCCchhCcCHHHHhh
Confidence            3566778999999999999999874


No 143
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=78.84  E-value=1.9  Score=32.36  Aligned_cols=27  Identities=30%  Similarity=0.644  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|+..+|..||++.+++..
T Consensus       247 ~~l~~li~~~l~~~p~~Rp~~~~il~~  273 (296)
T cd06618         247 PDFCSFVDLCLTKDHRKRPKYRELLQH  273 (296)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHhcC
Confidence            346677789999999999999998754


No 144
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=78.69  E-value=2  Score=31.23  Aligned_cols=26  Identities=12%  Similarity=0.372  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|+..+|.+||++.+++..
T Consensus       227 ~~~~li~~~l~~~P~~Rp~~~~il~~  252 (255)
T cd08219         227 ELRSLIKQMFKRNPRSRPSATTILSR  252 (255)
T ss_pred             HHHHHHHHHHhCCcccCCCHHHHhhc
Confidence            35567779999999999999998754


No 145
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=78.42  E-value=1.6  Score=33.42  Aligned_cols=25  Identities=32%  Similarity=0.679  Sum_probs=22.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       282 ~~~~li~~~l~~dP~~Rpt~~ell~  306 (327)
T cd08227         282 HFHHFVEQCLQRNPDARPSASTLLN  306 (327)
T ss_pred             HHHHHHHHHHhhCchhcCCHHHHhc
Confidence            4667888999999999999999986


No 146
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=78.40  E-value=2.3  Score=31.35  Aligned_cols=25  Identities=20%  Similarity=0.327  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       258 ~~~~li~~~l~~~p~~Rp~~~eil~  282 (286)
T cd07847         258 PALSFLKGCLQMDPTERLSCEELLE  282 (286)
T ss_pred             HHHHHHHHHhcCCccccCCHHHHhc
Confidence            4567888999999999999998864


No 147
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=78.06  E-value=2.5  Score=31.09  Aligned_cols=26  Identities=15%  Similarity=0.176  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++...|+..+|.+||++.+|+.
T Consensus       253 ~~~~~~i~~~l~~~P~~Rp~~~~~l~  278 (282)
T cd07829         253 PEGIDLLSKMLQYNPAKRISAKEALK  278 (282)
T ss_pred             HHHHHHHHHhhccCcccCCCHHHHhh
Confidence            35778888999999999999999874


No 148
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=77.89  E-value=2.4  Score=31.31  Aligned_cols=26  Identities=15%  Similarity=0.142  Sum_probs=22.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       256 ~~~~~li~~~l~~~p~~R~~~~~~l~  281 (286)
T cd07832         256 PEALDLLKGLLVYDPSKRLSAAEALR  281 (286)
T ss_pred             HHHHHHHHHHhccChhhCCCHHHHhh
Confidence            55677888999999999999999875


No 149
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=77.69  E-value=2.6  Score=31.07  Aligned_cols=26  Identities=15%  Similarity=0.107  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|..||++.+++.
T Consensus       258 ~~~~~li~~~l~~dp~~Rp~~~~il~  283 (287)
T cd07838         258 EEGLDLLKKMLTFNPHKRISAFEALQ  283 (287)
T ss_pred             HHHHHHHHHHhccCCccCCCHHHHhc
Confidence            44566788999999999999999873


No 150
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=77.61  E-value=2.2  Score=31.90  Aligned_cols=25  Identities=32%  Similarity=0.260  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|+..+|.+||++.+++.
T Consensus       259 ~~~~~i~~~l~~~P~~Rps~~~~l~  283 (294)
T PLN00009        259 AGVDLLSKMLRLDPSKRITARAALE  283 (294)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            3566888999999999999999885


No 151
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=77.59  E-value=2.1  Score=31.89  Aligned_cols=26  Identities=23%  Similarity=0.615  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+.++..+|++.+|..||++.+++..
T Consensus       228 ~~~~li~~~l~~~P~~Rp~~~eil~~  253 (279)
T cd06619         228 KFVHFITQCMRKQPKERPAPENLMDH  253 (279)
T ss_pred             HHHHHHHHHhhCChhhCCCHHHHhcC
Confidence            35667779999999999999998754


No 152
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]
Probab=77.54  E-value=5.2  Score=35.34  Aligned_cols=51  Identities=18%  Similarity=0.253  Sum_probs=36.4

Q ss_pred             ceecCcccCCCCHHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           11 EIVDPLIKVQISPNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        11 eivDp~L~~~~~~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      .|++-.-.-...+..-..|-.|...||+.+|.+||.+-+|+..+..+...+
T Consensus       265 aIlng~Y~~P~~p~ys~~l~~LI~~mL~~nP~~RPnI~Qv~~~~~~l~~~~  315 (738)
T KOG1989|consen  265 AILNGNYSFPPFPNYSDRLKDLIRTMLQPNPDERPNIYQVLEEIFELANKP  315 (738)
T ss_pred             eEEeccccCCCCccHHHHHHHHHHHHhccCcccCCCHHHHHHHHHHHhcCC
Confidence            555544322222455566667777899999999999999999998776543


No 153
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=77.22  E-value=2.6  Score=30.63  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=20.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       236 ~~~~li~~~l~~~p~~R~~~~~i~~  260 (264)
T cd06626         236 EGKDFLDRCLESDPKKRPTASELLQ  260 (264)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhc
Confidence            3456777999999999999999764


No 154
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=76.91  E-value=2.4  Score=30.63  Aligned_cols=25  Identities=32%  Similarity=0.488  Sum_probs=20.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       230 ~~~~li~~~l~~~p~~Rp~~~~~l~  254 (258)
T cd06632         230 EAKDFILKCLQRDPSLRPTAAELLE  254 (258)
T ss_pred             HHHHHHHHHhhcCcccCcCHHHHhc
Confidence            3455677999999999999999874


No 155
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=76.62  E-value=2.4  Score=31.56  Aligned_cols=24  Identities=21%  Similarity=0.192  Sum_probs=20.9

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|++.+|.+||++.+++.
T Consensus       263 ~~~li~~~l~~~P~~R~s~~~~l~  286 (290)
T cd07862         263 GKDLLLKCLTFNPAKRISAYSALS  286 (290)
T ss_pred             HHHHHHHHhccCchhcCCHHHHhc
Confidence            456888999999999999999874


No 156
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=76.58  E-value=3  Score=30.11  Aligned_cols=26  Identities=15%  Similarity=0.247  Sum_probs=22.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       227 ~~~~~li~~~l~~~p~~Rp~~~~~l~  252 (256)
T cd08530         227 QDLQNFIRSMLQVKPKLRPNCDKILA  252 (256)
T ss_pred             HHHHHHHHHHcCCCcccCCCHHHHhc
Confidence            44667888999999999999999874


No 157
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=76.52  E-value=2.3  Score=32.81  Aligned_cols=27  Identities=26%  Similarity=0.206  Sum_probs=23.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.+++..
T Consensus       265 ~~~~~li~~~l~~~P~~Rps~~ell~h  291 (337)
T cd07858         265 PLAIDLLEKMLVFDPSKRITVEEALAH  291 (337)
T ss_pred             HHHHHHHHHHhcCChhhccCHHHHHcC
Confidence            345678889999999999999998865


No 158
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=76.50  E-value=2.4  Score=31.59  Aligned_cols=25  Identities=24%  Similarity=0.246  Sum_probs=21.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       266 ~~~~~i~~~l~~~P~~R~~~~eil~  290 (295)
T cd07837         266 EGLDLLQKMLRYDPAKRISAKAALT  290 (295)
T ss_pred             HHHHHHHHHccCChhhcCCHHHHhc
Confidence            3566778999999999999999874


No 159
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=76.34  E-value=2.7  Score=32.31  Aligned_cols=25  Identities=20%  Similarity=0.171  Sum_probs=22.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|..||++.+++.
T Consensus       270 ~l~~li~~~l~~~P~~Rps~~~il~  294 (337)
T cd07852         270 DALDLLKKLLVFNPNKRLTAEEALE  294 (337)
T ss_pred             HHHHHHHHhccCCcccccCHHHHhh
Confidence            4567888999999999999999986


No 160
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=76.28  E-value=2.6  Score=30.55  Aligned_cols=26  Identities=35%  Similarity=0.629  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+|+.
T Consensus       234 ~~~~~li~~~l~~~p~~Rpt~~~il~  259 (262)
T cd06613         234 PVFHDFIKKCLTKDPKKRPTATKLLQ  259 (262)
T ss_pred             HHHHHHHHHHcCCChhhCCCHHHHhc
Confidence            34677889999999999999999864


No 161
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=76.04  E-value=3.2  Score=30.56  Aligned_cols=26  Identities=23%  Similarity=0.488  Sum_probs=22.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       229 ~~~~~~i~~~l~~~p~~R~~~~~il~  254 (277)
T cd06917         229 KLLREFVAACLDEEPKERLSAEELLK  254 (277)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHhh
Confidence            34666778999999999999999976


No 162
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=75.76  E-value=2.7  Score=31.41  Aligned_cols=25  Identities=20%  Similarity=0.140  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|+..+|.+||++.+++.
T Consensus       282 ~~~dli~~~l~~~P~~R~t~~e~l~  306 (310)
T cd07865         282 HALDLIDKLLVLDPAKRIDADTALN  306 (310)
T ss_pred             HHHHHHHHHhcCChhhccCHHHHhc
Confidence            4557889999999999999998874


No 163
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=75.75  E-value=2.3  Score=30.57  Aligned_cols=26  Identities=23%  Similarity=0.532  Sum_probs=21.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|.+||++.+++.
T Consensus       225 ~~~~~~i~~~l~~~p~~R~~~~~~l~  250 (254)
T cd06627         225 PELKDFLMQCFQKDPNLRPTAKQLLK  250 (254)
T ss_pred             HHHHHHHHHHHhCChhhCcCHHHHhc
Confidence            34567778999999999999999874


No 164
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=75.54  E-value=3  Score=31.16  Aligned_cols=26  Identities=27%  Similarity=0.136  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|.+||++.+++.
T Consensus       282 ~~~~~~i~~~l~~~p~~R~t~~ell~  307 (311)
T cd07866         282 PEGLDLLSKLLSLDPYKRLTASDALE  307 (311)
T ss_pred             hhHHHHHHHHcccCcccCcCHHHHhc
Confidence            45677888999999999999998864


No 165
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=75.24  E-value=2.8  Score=31.71  Aligned_cols=26  Identities=27%  Similarity=0.587  Sum_probs=22.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|+..+|..||++.+++..
T Consensus       242 ~~~~li~~~l~~~p~~Rp~~~~il~~  267 (307)
T cd06607         242 YFRNFVDSCLQKIPQDRPSSEELLKH  267 (307)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhcC
Confidence            45667779999999999999999764


No 166
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=75.14  E-value=2.9  Score=31.13  Aligned_cols=26  Identities=19%  Similarity=0.159  Sum_probs=22.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|..||++.+++.
T Consensus       262 ~~~~~li~~~L~~~p~~Rps~~e~l~  287 (291)
T cd07844         262 PHGEELALKFLQYEPKKRISAAEAMK  287 (291)
T ss_pred             hhHHHHHHHHhccCcccccCHHHHhc
Confidence            45567888999999999999999864


No 167
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=75.05  E-value=3.4  Score=29.94  Aligned_cols=26  Identities=27%  Similarity=0.641  Sum_probs=22.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+++.
T Consensus       230 ~~l~~li~~~l~~~p~~R~~~~~ll~  255 (264)
T cd06623         230 PEFRDFISACLQKDPKKRPSAAELLQ  255 (264)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHHh
Confidence            45667778899999999999999876


No 168
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=74.79  E-value=3  Score=29.89  Aligned_cols=26  Identities=19%  Similarity=0.529  Sum_probs=21.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||+..+++.
T Consensus       229 ~~~~~~i~~~l~~~p~~Rp~~~~ll~  254 (258)
T cd08215         229 SELRNLVSSLLQKDPEERPSIAQILQ  254 (258)
T ss_pred             HHHHHHHHHHcCCChhhCcCHHHHhc
Confidence            34566778999999999999999874


No 169
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=74.40  E-value=3.4  Score=30.10  Aligned_cols=26  Identities=27%  Similarity=0.489  Sum_probs=21.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.++++
T Consensus       231 ~~~~~li~~~l~~~p~~Rp~~~~il~  256 (260)
T cd08222         231 RQLNSIMQSMLNKDPSLRPSAAEILR  256 (260)
T ss_pred             HHHHHHHHHHhcCChhhCcCHHHHhh
Confidence            34566777999999999999999875


No 170
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=74.35  E-value=3.2  Score=30.35  Aligned_cols=25  Identities=24%  Similarity=0.518  Sum_probs=20.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       237 ~~~~~i~~~l~~~p~~Rp~~~~~l~  261 (265)
T cd06631         237 AAIDFVTSCLTRDQHERPSALQLLR  261 (265)
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHhc
Confidence            3456778999999999999998864


No 171
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=74.22  E-value=3.2  Score=30.96  Aligned_cols=25  Identities=20%  Similarity=0.171  Sum_probs=21.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|.+||++.+++.
T Consensus       265 ~~~~li~~~l~~~p~~R~t~~ell~  289 (293)
T cd07843         265 NGFDLLNRLLTYDPAKRISAEDALK  289 (293)
T ss_pred             HHHHHHHHHhccCccccCCHHHHhc
Confidence            3456777999999999999999874


No 172
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=74.19  E-value=3.3  Score=30.93  Aligned_cols=26  Identities=19%  Similarity=0.188  Sum_probs=22.1

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++...|++.+|.+||++.+++.
T Consensus       273 ~~~~~li~~~l~~~P~~Rp~~~~il~  298 (302)
T cd07864         273 TPALDLLDHMLTLDPSKRCTAEEALN  298 (302)
T ss_pred             HHHHHHHHHHccCChhhCCCHHHHhc
Confidence            34677888999999999999998874


No 173
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=74.08  E-value=3.1  Score=32.26  Aligned_cols=26  Identities=19%  Similarity=0.225  Sum_probs=22.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+.++..+|+..+|.+||++.+++..
T Consensus       286 ~~~~li~~mL~~dP~~Rps~~ell~h  311 (355)
T cd07874         286 QARDLLSKMLVIDPAKRISVDEALQH  311 (355)
T ss_pred             HHHHHHHHHhcCCchhcCCHHHHhcC
Confidence            45678889999999999999998864


No 174
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=73.94  E-value=3.1  Score=31.63  Aligned_cols=25  Identities=36%  Similarity=0.448  Sum_probs=21.6

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+..+|++.+|.+||++.+++..
T Consensus       266 ~~~li~~~l~~~P~~Rpt~~e~l~h  290 (338)
T cd07859         266 ALRLLERLLAFDPKDRPTAEEALAD  290 (338)
T ss_pred             HHHHHHHHcCcCcccCCCHHHHhcC
Confidence            4578889999999999999998853


No 175
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=73.68  E-value=5.1  Score=33.58  Aligned_cols=39  Identities=31%  Similarity=0.561  Sum_probs=31.0

Q ss_pred             CHHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhhhh
Q 033105           22 SPNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQQT   63 (127)
Q Consensus        22 ~~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~~~   63 (127)
                      .+..+..++   .+|...+|.+||+|.+|.+.|+.+......
T Consensus       388 ~p~~~~~~~---~~c~~~~p~~R~tm~~i~~~l~~~~~~~~~  426 (474)
T KOG0194|consen  388 TPKELAKVM---KQCWKKDPEDRPTMSTIKKKLEALEKKKEA  426 (474)
T ss_pred             CHHHHHHHH---HHhccCChhhccCHHHHHHHHHHHHhcccc
Confidence            344455444   499999999999999999999998876654


No 176
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=73.66  E-value=3.3  Score=31.52  Aligned_cols=29  Identities=28%  Similarity=0.512  Sum_probs=23.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      .+..+..+|++.+|.+||++.+|+..+..
T Consensus       252 ~l~~li~~~l~~~p~~Rpt~~~il~~~~~  280 (317)
T cd06635         252 YFRNFVDSCLQKIPQDRPTSEELLKHMFV  280 (317)
T ss_pred             HHHHHHHHHccCCcccCcCHHHHHhChhh
Confidence            35667779999999999999999875543


No 177
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=73.25  E-value=3.5  Score=31.91  Aligned_cols=26  Identities=31%  Similarity=0.234  Sum_probs=22.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+|+.
T Consensus       272 ~~l~dli~~~l~~~P~~Rpt~~ell~  297 (343)
T cd07851         272 PLAIDLLEKMLVLDPDKRITAAEALA  297 (343)
T ss_pred             HHHHHHHHHhCCCChhhCCCHHHHhc
Confidence            34667888999999999999999864


No 178
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=73.14  E-value=3.3  Score=30.62  Aligned_cols=26  Identities=12%  Similarity=0.059  Sum_probs=21.7

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|.+||++.+++.
T Consensus       255 ~~~~~li~~~l~~~P~~R~t~~~il~  280 (284)
T cd07839         255 STGRDLLQNLLVCNPVQRISAEEALQ  280 (284)
T ss_pred             HHHHHHHHHHhcCChhhcCCHHHHhc
Confidence            34556788999999999999998864


No 179
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=73.12  E-value=3.6  Score=30.14  Aligned_cols=25  Identities=24%  Similarity=0.438  Sum_probs=21.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       240 ~~~~li~~~l~~~P~~R~~~~~ll~  264 (267)
T cd06645         240 SFHHFVKMALTKNPKKRPTAEKLLQ  264 (267)
T ss_pred             HHHHHHHHHccCCchhCcCHHHHhc
Confidence            3566788999999999999998864


No 180
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=73.12  E-value=2.9  Score=32.11  Aligned_cols=26  Identities=23%  Similarity=0.266  Sum_probs=22.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|++.+|.+||++.+++..
T Consensus       267 ~~~~li~~~l~~dP~~Rpt~~e~l~h  292 (336)
T cd07849         267 KALDLLDKMLTFNPHKRITVEEALAH  292 (336)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHhcC
Confidence            46678889999999999999988765


No 181
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=72.52  E-value=3.3  Score=30.73  Aligned_cols=25  Identities=32%  Similarity=0.541  Sum_probs=20.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|.+||++.+++.
T Consensus       237 ~~~~li~~~l~~~p~~Rp~~~~il~  261 (282)
T cd06643         237 EFKDFLKKCLEKNVDARWTTTQLLQ  261 (282)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            4566778999999999999988754


No 182
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=72.17  E-value=4.5  Score=30.67  Aligned_cols=27  Identities=30%  Similarity=0.481  Sum_probs=22.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      .+..+..+|+..+|.+||++.+|+...
T Consensus       242 ~~~~li~~cl~~~P~~Rp~~~~ll~~~  268 (308)
T cd06634         242 YFRNFVDSCLQKIPQDRPTSEVLLKHR  268 (308)
T ss_pred             HHHHHHHHHhhCCcccCCCHHHHhhCc
Confidence            355677799999999999999987653


No 183
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=72.15  E-value=3.6  Score=31.01  Aligned_cols=24  Identities=29%  Similarity=0.620  Sum_probs=20.9

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|++.+|..||++.+++.
T Consensus       245 ~~~li~~~l~~~p~~Rps~~~il~  268 (297)
T cd06656         245 FRDFLNRCLEMDVDRRGSAKELLQ  268 (297)
T ss_pred             HHHHHHHHccCChhhCcCHHHHhc
Confidence            455778999999999999999887


No 184
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=72.12  E-value=3.8  Score=30.33  Aligned_cols=25  Identities=16%  Similarity=0.006  Sum_probs=21.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|.+||++.+++.
T Consensus       260 ~~~~li~~~L~~dP~~R~t~~~~l~  284 (288)
T cd07863         260 SGAQLLLEMLTFNPHKRISAFRALQ  284 (288)
T ss_pred             HHHHHHHHHhccCcccCCCHHHHhc
Confidence            3567788999999999999988864


No 185
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]
Probab=71.99  E-value=7.5  Score=31.31  Aligned_cols=37  Identities=19%  Similarity=0.366  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      +-..+..+..+|-..+|..||++.+++..|+.+..-.
T Consensus       271 ~~~~l~~l~~~CW~~dp~~RP~f~ei~~~l~~~~~~~  307 (362)
T KOG0192|consen  271 CPPHLSSLMERCWLVDPSRRPSFLEIVSRLESIMSHI  307 (362)
T ss_pred             CCHHHHHHHHHhCCCCCCcCCCHHHHHHHHHHHHHhh
Confidence            4455666677799999999999999999999887633


No 186
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=71.26  E-value=4.4  Score=30.55  Aligned_cols=25  Identities=24%  Similarity=0.542  Sum_probs=21.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       245 ~l~~li~~~l~~~p~~Rpt~~eil~  269 (296)
T cd06654         245 IFRDFLNRCLDMDVEKRGSAKELLQ  269 (296)
T ss_pred             HHHHHHHHHCcCCcccCcCHHHHhh
Confidence            3556778999999999999999986


No 187
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=71.05  E-value=4.7  Score=29.41  Aligned_cols=25  Identities=28%  Similarity=0.416  Sum_probs=20.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       239 ~~~~li~~~l~~~p~~Rp~~~~il~  263 (267)
T cd06628         239 EAIDFLEKTFEIDHNKRPTAAELLK  263 (267)
T ss_pred             HHHHHHHHHccCCchhCcCHHHHhh
Confidence            3455667999999999999998875


No 188
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=70.96  E-value=3.9  Score=30.23  Aligned_cols=26  Identities=38%  Similarity=0.727  Sum_probs=21.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+.++...|+..+|..||++.+|+..
T Consensus       237 ~~~~li~~~l~~~p~~Rps~~~il~~  262 (280)
T cd06611         237 SFNDFLKSCLVKDPDDRPTAAELLKH  262 (280)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHhcC
Confidence            45567779999999999999998653


No 189
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=70.95  E-value=4.3  Score=30.14  Aligned_cols=26  Identities=31%  Similarity=0.707  Sum_probs=22.1

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|++.+|..||++.+++..
T Consensus       245 ~l~~li~~~l~~~p~~Rpt~~~il~~  270 (286)
T cd06614         245 EFKDFLNKCLVKDPEKRPSAEELLQH  270 (286)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHhhC
Confidence            45667889999999999999999753


No 190
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=70.88  E-value=4.6  Score=29.36  Aligned_cols=26  Identities=15%  Similarity=0.357  Sum_probs=21.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|+..+|..||++.+++.
T Consensus       234 ~~~~~li~~~l~~~p~~Rpt~~~ll~  259 (263)
T cd06625         234 PDARNFLRRTFVENAKKRPSAEELLR  259 (263)
T ss_pred             HHHHHHHHHHhhcCcccCCCHHHHhh
Confidence            34556777999999999999999875


No 191
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=70.78  E-value=3.6  Score=30.18  Aligned_cols=23  Identities=22%  Similarity=0.374  Sum_probs=18.0

Q ss_pred             HHHHHhhcCcCCCCCCCHHHHHH
Q 033105           30 AEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        30 ~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +...++|+..+|.+||++.+|+.
T Consensus       238 ~~~li~~~~~~p~~Rp~~~eil~  260 (266)
T cd06651         238 ARDFLGCIFVEARHRPSAEELLR  260 (266)
T ss_pred             HHHHHHHhcCChhhCcCHHHHhc
Confidence            33345788889999999999864


No 192
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=70.71  E-value=5.2  Score=30.68  Aligned_cols=26  Identities=23%  Similarity=0.185  Sum_probs=22.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|.+||++.+++.
T Consensus       266 ~~~~~li~~~l~~~P~~R~t~~~ll~  291 (332)
T cd07857         266 PLALDLLEKLLAFDPTKRISVEEALE  291 (332)
T ss_pred             HHHHHHHHHHccCCcccCCCHHHHhc
Confidence            35667888999999999999998753


No 193
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=70.43  E-value=4.2  Score=31.57  Aligned_cols=25  Identities=20%  Similarity=0.363  Sum_probs=21.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       303 ~l~~li~~~l~~~P~~Rpt~~ell~  327 (353)
T PLN00034        303 EFRHFISCCLQREPAKRWSAMQLLQ  327 (353)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            4566777999999999999999876


No 194
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=70.01  E-value=4.9  Score=29.96  Aligned_cols=25  Identities=20%  Similarity=0.444  Sum_probs=21.4

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       244 ~~~~li~~~l~~~p~~Rp~~~~il~  268 (292)
T cd06644         244 EFRDFLKTALDKHPETRPSAAQLLE  268 (292)
T ss_pred             HHHHHHHHHhcCCcccCcCHHHHhc
Confidence            4666778999999999999998864


No 195
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=69.82  E-value=4.7  Score=29.88  Aligned_cols=24  Identities=17%  Similarity=0.234  Sum_probs=21.3

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +.++..+|++.+|.+||+..+++.
T Consensus       260 ~~dll~~~L~~~P~~R~s~~~~l~  283 (287)
T cd07848         260 LLDLMKNLLKLNPTDRYLTEQCLN  283 (287)
T ss_pred             HHHHHHHHccCCcccCCCHHHHhc
Confidence            677888999999999999998864


No 196
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=69.78  E-value=4.8  Score=29.94  Aligned_cols=25  Identities=28%  Similarity=0.288  Sum_probs=21.1

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|+..+|..||++.+++.
T Consensus       263 ~~~~ll~~~l~~dp~~R~t~~~~l~  287 (291)
T cd07870         263 KAEDLASQMLMMFPKDRISAQDALL  287 (291)
T ss_pred             HHHHHHHHHhCcCcccCcCHHHHhc
Confidence            4556778999999999999999863


No 197
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=69.69  E-value=4.3  Score=30.03  Aligned_cols=25  Identities=32%  Similarity=0.547  Sum_probs=21.1

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||+..+++.
T Consensus       254 ~~~~li~~cl~~~p~~Rp~~~ell~  278 (282)
T cd06636         254 KFIDFIEGCLVKNYLSRPSTEQLLK  278 (282)
T ss_pred             HHHHHHHHHhCCChhhCcCHHHHhc
Confidence            4666777999999999999998863


No 198
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=69.32  E-value=4.8  Score=31.09  Aligned_cols=30  Identities=27%  Similarity=0.281  Sum_probs=23.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH--HHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD--LEYA   57 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~--Le~~   57 (127)
                      .+.++..+|++.+|.+||++.+++..  ++..
T Consensus       272 ~~~~li~~~l~~dP~~R~~~~e~l~h~~f~~~  303 (342)
T cd07879         272 QAVDLLEKMLELDVDKRLTATEALEHPYFDSF  303 (342)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHhcCcchhhc
Confidence            35678889999999999999999843  4443


No 199
>PHA03209 serine/threonine kinase US3; Provisional
Probab=69.23  E-value=3.8  Score=31.98  Aligned_cols=21  Identities=29%  Similarity=0.431  Sum_probs=18.8

Q ss_pred             HHHhhcCcCCCCCCCHHHHHH
Q 033105           32 IAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        32 la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+|++.+|.+||++.+|+.
T Consensus       330 li~~mL~~dP~~Rpta~e~l~  350 (357)
T PHA03209        330 LVHKMLTFDAAMRPSAEEILN  350 (357)
T ss_pred             HHHHHHcCCcccCcCHHHHhc
Confidence            667999999999999999874


No 200
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=69.15  E-value=3.1  Score=30.93  Aligned_cols=30  Identities=13%  Similarity=0.005  Sum_probs=24.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      .+..+..+|++.+|..||++.+|...|+..
T Consensus       238 ~l~~li~~~l~~~p~~R~t~~~~~~~l~~~  267 (288)
T cd05583         238 EARDFIQKLLEKDPKKRLGANGADEIKNHP  267 (288)
T ss_pred             HHHHHHHHHhcCCHhhccCcchHHHHhcCc
Confidence            345667799999999999999998877653


No 201
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=68.30  E-value=4.3  Score=30.36  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=21.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||++.+++.
T Consensus       244 ~l~~li~~~l~~~p~~Rpt~~~il~  268 (285)
T cd06648         244 RLRSFLDRMLVRDPAQRATAAELLN  268 (285)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHcc
Confidence            4667788999999999999998874


No 202
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=68.24  E-value=5.1  Score=31.03  Aligned_cols=26  Identities=23%  Similarity=0.281  Sum_probs=22.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|++.+|..||++.+++.
T Consensus       285 ~~~~~li~~~L~~dP~~R~t~~eiL~  310 (353)
T cd07850         285 SQARDLLSKMLVIDPEKRISVDDALQ  310 (353)
T ss_pred             hHHHHHHHHHcCCChhhCcCHHHHhc
Confidence            34567888999999999999999875


No 203
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=68.12  E-value=5  Score=29.57  Aligned_cols=25  Identities=16%  Similarity=0.127  Sum_probs=20.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++-.+|++.+|.+||++.+++.
T Consensus       256 ~~~~~i~~~l~~~p~~R~~~~~~l~  280 (284)
T cd07836         256 LGIDLLHRLLQLNPELRISAHDALQ  280 (284)
T ss_pred             HHHHHHHHHhcCCcccCCCHHHHhc
Confidence            3456778999999999999999874


No 204
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=68.12  E-value=4.7  Score=30.66  Aligned_cols=25  Identities=24%  Similarity=0.555  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|..||++.+++.
T Consensus       248 ~l~~li~~~l~~~P~~Rp~~~~~l~  272 (313)
T cd06633         248 SFRGFVDYCLQKIPQERPASAELLR  272 (313)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            3566777999999999999999875


No 205
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=67.77  E-value=5.4  Score=30.59  Aligned_cols=27  Identities=19%  Similarity=0.265  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.+++..
T Consensus       268 ~~~~~li~~~l~~~P~~Rpt~~~~l~~  294 (334)
T cd07855         268 PEALDLLSQMLQFDPEERITVEQALQH  294 (334)
T ss_pred             HHHHHHHHHHccCChhhCcCHHHHHhC
Confidence            456678889999999999999987763


No 206
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=67.47  E-value=4.9  Score=30.33  Aligned_cols=24  Identities=25%  Similarity=0.603  Sum_probs=20.5

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|+..+|.+||++.+++.
T Consensus       245 ~~~li~~~l~~dp~~Rpt~~~il~  268 (296)
T cd06655         245 FRDFLNRCLEMDVEKRGSAKELLQ  268 (296)
T ss_pred             HHHHHHHHhhcChhhCCCHHHHhh
Confidence            455678999999999999999874


No 207
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=67.21  E-value=5.2  Score=29.48  Aligned_cols=25  Identities=28%  Similarity=0.723  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||+..+++.
T Consensus       236 ~l~~li~~~l~~~p~~Rp~~~~il~  260 (283)
T cd06617         236 EFQDFVNKCLKKNYKERPNYPELLQ  260 (283)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhc
Confidence            4566778899999999999999876


No 208
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=67.16  E-value=5.8  Score=30.14  Aligned_cols=26  Identities=27%  Similarity=0.229  Sum_probs=22.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+.++..+|++.+|.+||++.+++..
T Consensus       264 ~~~~li~~~l~~~P~~Rpt~~~ll~~  289 (330)
T cd07834         264 EAIDLLEKMLVFDPKKRITADEALAH  289 (330)
T ss_pred             HHHHHHHHHccCChhhCCCHHHHHhC
Confidence            35668889999999999999998864


No 209
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=66.66  E-value=7.2  Score=28.86  Aligned_cols=26  Identities=27%  Similarity=0.445  Sum_probs=21.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+..+..+|++.+|..||++.+++.
T Consensus       236 ~~~~~li~~~l~~~p~~Rp~~~~l~~  261 (286)
T cd06622         236 DDAQDFVAKCLNKIPNRRPTYAQLLE  261 (286)
T ss_pred             HHHHHHHHHHcccCcccCCCHHHHhc
Confidence            34456778999999999999998876


No 210
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=66.64  E-value=5.6  Score=29.93  Aligned_cols=24  Identities=25%  Similarity=0.159  Sum_probs=20.8

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|+..+|.+||+..+++.
T Consensus       290 ~~~ll~~~l~~dP~~R~t~~e~l~  313 (317)
T cd07867         290 VFLLLQKLLTMDPTKRITSEQALQ  313 (317)
T ss_pred             HHHHHHHHhccCcccccCHHHHhc
Confidence            556788999999999999999874


No 211
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=66.59  E-value=6  Score=30.26  Aligned_cols=26  Identities=12%  Similarity=0.179  Sum_probs=22.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|+..+|.+||++.+++.
T Consensus       287 ~~~~~li~~~l~~~P~~R~s~~~~l~  312 (335)
T PTZ00024        287 DDAIDLLQSLLKLNPLERISAKEALK  312 (335)
T ss_pred             hHHHHHHHHHcCCCchhccCHHHHhc
Confidence            34667888999999999999999885


No 212
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=65.89  E-value=5.5  Score=29.89  Aligned_cols=24  Identities=25%  Similarity=0.291  Sum_probs=21.0

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|+..+|.+||++.+++.
T Consensus       262 ~~~li~~ml~~dp~~R~t~~eil~  285 (301)
T cd07873         262 GAELLSKLLQFEGRKRISAEEAMK  285 (301)
T ss_pred             HHHHHHHHhcCCcccCcCHHHHhc
Confidence            456788999999999999999875


No 213
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=64.89  E-value=7  Score=30.08  Aligned_cols=27  Identities=22%  Similarity=0.185  Sum_probs=21.9

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+..+..+|++.+|.+||++.+++..
T Consensus       262 ~~~~~li~~~l~~~P~~R~t~~ell~~  288 (328)
T cd07856         262 PSAIDLLEKMLVFDPQKRISAAEALAH  288 (328)
T ss_pred             HHHHHHHHHHcCCChhhCCCHHHHhcC
Confidence            356677789999999999999887543


No 214
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=64.35  E-value=7.4  Score=28.31  Aligned_cols=26  Identities=27%  Similarity=0.593  Sum_probs=22.0

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+.++..+|+..+|..||+..+++.
T Consensus       238 ~~~~~~i~~~l~~~p~~R~~~~~ll~  263 (268)
T cd06630         238 PGLRDVTLRCLELQPEDRPPSRELLK  263 (268)
T ss_pred             HHHHHHHHHHcCCCcccCcCHHHHhc
Confidence            45667888999999999999999874


No 215
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=64.03  E-value=7.2  Score=30.11  Aligned_cols=25  Identities=24%  Similarity=0.226  Sum_probs=21.5

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|.+||+..+++.
T Consensus       275 ~~~~li~~~L~~dP~~R~t~~ell~  299 (342)
T cd07854         275 EALDFLEQILTFNPMDRLTAEEALM  299 (342)
T ss_pred             HHHHHHHHHhCCCchhccCHHHHhC
Confidence            4557888999999999999999874


No 216
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=63.96  E-value=7  Score=30.54  Aligned_cols=26  Identities=23%  Similarity=0.183  Sum_probs=22.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|++.+|.+||++.+++..
T Consensus       263 ~~~~li~~mL~~dP~~R~t~~e~l~h  288 (372)
T cd07853         263 EAVHLLCRMLVFDPDKRISAADALAH  288 (372)
T ss_pred             HHHHHHHHhCCCChhhCcCHHHHhcC
Confidence            45678889999999999999998753


No 217
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=63.92  E-value=6.3  Score=29.70  Aligned_cols=25  Identities=20%  Similarity=0.065  Sum_probs=21.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       265 ~~~~li~~ml~~dp~~R~t~~~il~  289 (309)
T cd07845         265 AGLRLLNFLLMYDPKKRATAEEALE  289 (309)
T ss_pred             HHHHHHHHHhcCChhhCcCHHHHhc
Confidence            3456778999999999999999885


No 218
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=63.37  E-value=9.2  Score=27.99  Aligned_cols=24  Identities=33%  Similarity=0.453  Sum_probs=18.5

Q ss_pred             HHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           31 EIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        31 ~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      .+-..|. .+|.+||++.+|+..|.
T Consensus       245 ~~~~~~~-~dp~~Rpt~~~v~~~l~  268 (269)
T cd05042         245 EVMQFCW-LDPETRPTAEEVHELLT  268 (269)
T ss_pred             HHHHHHh-cCcccccCHHHHHHHhc
Confidence            3445565 59999999999998773


No 219
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=61.77  E-value=8.5  Score=29.92  Aligned_cols=25  Identities=20%  Similarity=0.267  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|.+||+..+++.
T Consensus       293 ~~~dll~~mL~~dP~~R~t~~e~L~  317 (364)
T cd07875         293 QARDLLSKMLVIDASKRISVDEALQ  317 (364)
T ss_pred             HHHHHHHHhcCcCcccCCCHHHHhc
Confidence            4567788999999999999999875


No 220
>PLN00181 protein SPA1-RELATED; Provisional
Probab=61.53  E-value=7.2  Score=34.16  Aligned_cols=25  Identities=28%  Similarity=0.292  Sum_probs=20.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ....+..+|++.+|..||+|.+|+.
T Consensus       240 ~~~~~~~~~L~~~P~~Rps~~eil~  264 (793)
T PLN00181        240 KEASFCLWLLHPEPSCRPSMSELLQ  264 (793)
T ss_pred             HHHHHHHHhCCCChhhCcChHHHhh
Confidence            3456677899999999999999864


No 221
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=61.11  E-value=5  Score=28.92  Aligned_cols=29  Identities=14%  Similarity=0.083  Sum_probs=22.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..+..+..+|++.+|..||++..|...|+
T Consensus       228 ~~~~~~i~~~l~~~p~~Rpt~~~~~~~l~  256 (265)
T cd05579         228 DEAIDLISKLLVPDPEKRLGAKSIEEIKN  256 (265)
T ss_pred             HHHHHHHHHHhcCCHhhcCCCccHHHHhc
Confidence            44566778899999999999966666554


No 222
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=60.25  E-value=8.7  Score=29.80  Aligned_cols=25  Identities=24%  Similarity=0.295  Sum_probs=21.4

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +.++-.+|+..+|.+||++.+++..
T Consensus       291 ~~~li~~mL~~dP~~R~t~~e~l~h  315 (359)
T cd07876         291 ARDLLSKMLVIDPDKRISVDEALRH  315 (359)
T ss_pred             HHHHHHHHhccCcccCCCHHHHhcC
Confidence            4567789999999999999999763


No 223
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=60.09  E-value=8.8  Score=28.96  Aligned_cols=24  Identities=21%  Similarity=0.101  Sum_probs=20.9

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|++.+|.+||+..+++.
T Consensus       290 ~~dli~~mL~~dP~~R~t~~e~l~  313 (317)
T cd07868         290 AFHLLQKLLTMDPIKRITSEQAMQ  313 (317)
T ss_pred             HHHHHHHHhccCcccCCCHHHHhc
Confidence            556788999999999999999874


No 224
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=59.52  E-value=11  Score=28.42  Aligned_cols=25  Identities=20%  Similarity=0.404  Sum_probs=21.6

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+...|++.+|..||++.+++..
T Consensus       247 l~~~i~~~l~~~P~~Rps~~~ll~~  271 (297)
T cd06659         247 LRDFLERMLTREPQERATAQELLDH  271 (297)
T ss_pred             HHHHHHHHhcCCcccCcCHHHHhhC
Confidence            5567779999999999999999874


No 225
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=59.35  E-value=3.9  Score=35.22  Aligned_cols=45  Identities=20%  Similarity=0.372  Sum_probs=30.0

Q ss_pred             CccceecCcccCCCCH-HHHHHHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105            8 LLEEIVDPLIKVQISP-NSLRKFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus         8 ~l~eivDp~L~~~~~~-~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ++..|.||.-.-+++. -.-..++.++-.|++.+|.+||++.+++.
T Consensus       581 Kl~aI~~P~~~Iefp~~~~~~~li~~mK~CL~rdPkkR~si~eLLq  626 (677)
T KOG0596|consen  581 KLHAITDPNHEIEFPDIPENDELIDVMKCCLARDPKKRWSIPELLQ  626 (677)
T ss_pred             HHHhhcCCCccccccCCCCchHHHHHHHHHHhcCcccCCCcHHHhc
Confidence            4566778854222210 00112778888999999999999999865


No 226
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=59.24  E-value=9.4  Score=28.69  Aligned_cols=25  Identities=16%  Similarity=0.262  Sum_probs=20.3

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+-.+|+..+|.+||++.+++..
T Consensus       248 ~~~li~~~l~~~P~~Rpt~~~il~~  272 (292)
T cd06658         248 LRGFLDLMLVREPSQRATAQELLQH  272 (292)
T ss_pred             HHHHHHHHccCChhHCcCHHHHhhC
Confidence            3455668999999999999998864


No 227
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=58.41  E-value=9.8  Score=28.56  Aligned_cols=26  Identities=23%  Similarity=0.535  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|+..+|.+||++.+++..
T Consensus       244 ~l~~li~~~l~~~p~~Rp~~~~il~h  269 (293)
T cd06647         244 IFRDFLNRCLEMDVEKRGSAKELLQH  269 (293)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHhcC
Confidence            35567789999999999999998754


No 228
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=56.50  E-value=11  Score=28.39  Aligned_cols=25  Identities=20%  Similarity=0.167  Sum_probs=21.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+.++..+|++.+|.+||++.+++.
T Consensus       263 ~~~dli~~mL~~dp~~R~s~~~~l~  287 (303)
T cd07869         263 HAEDLASKLLQCFPKNRLSAQAALS  287 (303)
T ss_pred             HHHHHHHHHhccCchhccCHHHHhc
Confidence            3456778999999999999998874


No 229
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=56.48  E-value=12  Score=31.07  Aligned_cols=25  Identities=28%  Similarity=0.408  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       272 ~l~~li~~~L~~dP~~RPs~~ell~  296 (496)
T PTZ00283        272 EMQEIVTALLSSDPKRRPSSSKLLN  296 (496)
T ss_pred             HHHHHHHHHcccChhhCcCHHHHHh
Confidence            4567788999999999999999875


No 230
>PHA02882 putative serine/threonine kinase; Provisional
Probab=56.28  E-value=12  Score=28.07  Aligned_cols=28  Identities=7%  Similarity=0.135  Sum_probs=23.2

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+.++...|...++.+||++.++.+.|
T Consensus       266 ~~~~~~~~~~~~~~~~~rp~~~~l~~~~  293 (294)
T PHA02882        266 KFIYDFIECVTKLSYEEKPDYDALIKIF  293 (294)
T ss_pred             HHHHHHHHHHHhCCCCCCCCHHHHHHhh
Confidence            3455677789999999999999998876


No 231
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=56.19  E-value=11  Score=29.15  Aligned_cols=24  Identities=29%  Similarity=0.288  Sum_probs=21.1

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|++.+|.+||++.+++.
T Consensus       274 ~~~li~~~l~~dP~~R~t~~~~l~  297 (343)
T cd07880         274 AVNVLEKMLVLDAESRITAAEALA  297 (343)
T ss_pred             HHHHHHHHcCCChhhCCCHHHHhc
Confidence            567778999999999999999884


No 232
>PHA03211 serine/threonine kinase US3; Provisional
Probab=54.97  E-value=11  Score=31.12  Aligned_cols=25  Identities=24%  Similarity=0.355  Sum_probs=21.3

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+..+|++.+|.+||+..+++..
T Consensus       431 ~~dli~~mL~~DP~~RPsa~elL~h  455 (461)
T PHA03211        431 VEYLVCRALTFDGARRPSAAELLRL  455 (461)
T ss_pred             HHHHHHHHcccChhhCcCHHHHhhC
Confidence            4567779999999999999999763


No 233
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=54.22  E-value=13  Score=28.60  Aligned_cols=24  Identities=29%  Similarity=0.314  Sum_probs=20.9

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+..+|+..+|.+||+..+++.
T Consensus       274 ~~~li~~mL~~dp~~R~s~~ell~  297 (343)
T cd07878         274 AIDLLEKMLVLDSDKRISASEALA  297 (343)
T ss_pred             HHHHHHHHcCCChhhCCCHHHHhc
Confidence            456778999999999999999885


No 234
>PTZ00284 protein kinase; Provisional
Probab=53.89  E-value=12  Score=30.44  Aligned_cols=25  Identities=16%  Similarity=0.154  Sum_probs=21.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||++.+++.
T Consensus       413 ~~~dli~~mL~~dP~~R~ta~e~L~  437 (467)
T PTZ00284        413 LLCDLIYGLLHYDRQKRLNARQMTT  437 (467)
T ss_pred             HHHHHHHHhCCcChhhCCCHHHHhc
Confidence            3557888999999999999999885


No 235
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=53.28  E-value=13  Score=28.06  Aligned_cols=24  Identities=21%  Similarity=0.304  Sum_probs=20.3

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+-.+|+..+|.+||++.+++.
T Consensus       246 l~~li~~~l~~~P~~R~~~~~ll~  269 (292)
T cd06657         246 LKGFLDRLLVRDPAQRATAAELLK  269 (292)
T ss_pred             HHHHHHHHHhCCcccCcCHHHHhc
Confidence            445667899999999999999876


No 236
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=51.46  E-value=9.8  Score=28.63  Aligned_cols=28  Identities=11%  Similarity=0.067  Sum_probs=23.0

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      +..+..+|++.+|.+||+...+...|+.
T Consensus       246 ~~~li~~~l~~~P~~R~~~~~~~~ll~~  273 (305)
T cd05609         246 AQDLISRLLRQNPLERLGTGGAFEVKQH  273 (305)
T ss_pred             HHHHHHHHhccChhhccCccCHHHHHhC
Confidence            5678889999999999998777766665


No 237
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=50.79  E-value=14  Score=30.23  Aligned_cols=25  Identities=20%  Similarity=0.337  Sum_probs=21.2

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+..+|+..+|..||++.+++.
T Consensus       298 ~~~~li~~~L~~dP~~Rps~~~~l~  322 (478)
T PTZ00267        298 GMKALLDPLLSKNPALRPTTQQLLH  322 (478)
T ss_pred             HHHHHHHHHhccChhhCcCHHHHHh
Confidence            4566778999999999999999864


No 238
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=49.09  E-value=13  Score=27.11  Aligned_cols=20  Identities=30%  Similarity=0.312  Sum_probs=17.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCH
Q 033105           28 KFAEIAEKCLREDGDDRPTM   47 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM   47 (127)
                      .+..+..+|+..+|.+||+.
T Consensus       248 ~~~~li~~~l~~~p~~R~~~  267 (280)
T cd05581         248 DAKDLIEKLLVLDPQDRLGV  267 (280)
T ss_pred             HHHHHHHHHhcCCHhhCCCc
Confidence            45677889999999999999


No 239
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=48.98  E-value=41  Score=31.08  Aligned_cols=41  Identities=17%  Similarity=0.285  Sum_probs=33.3

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhhhhcc
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQQTAR   65 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~~~~~   65 (127)
                      |=.++.+|-..|-+.+|.+||+...++..+..+.....+..
T Consensus       929 CP~~ly~lM~~CW~~~pe~RP~F~~i~~q~~~i~~~~~~~~  969 (1025)
T KOG1095|consen  929 CPEKLYQLMLQCWKHDPEDRPSFRTIVEQDPAISNAALGTI  969 (1025)
T ss_pred             CChHHHHHHHHHccCChhhCccHHHHHhhhhhhhhhhccCc
Confidence            34556678889999999999999999999988877655543


No 240
>PHA03212 serine/threonine kinase US3; Provisional
Probab=48.39  E-value=16  Score=29.18  Aligned_cols=25  Identities=24%  Similarity=0.274  Sum_probs=21.0

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .+..+-.+|++.+|.+||+..+++.
T Consensus       351 ~l~~Li~~mL~~dP~~Rpta~elL~  375 (391)
T PHA03212        351 DLEYLICKMLAFDAHHRPSAEALLD  375 (391)
T ss_pred             hHHHHHHHHhcCChhhCCCHHHHhc
Confidence            3556778999999999999999875


No 241
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=47.34  E-value=18  Score=27.23  Aligned_cols=24  Identities=17%  Similarity=0.194  Sum_probs=20.7

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +.++..+|+..+|.+||+..+++.
T Consensus       262 ~~~li~~~L~~dp~~R~t~~e~l~  285 (309)
T cd07872         262 GIELLTKFLQYESKKRISAEEAMK  285 (309)
T ss_pred             HHHHHHHhccCChhhCCCHHHHhc
Confidence            456778999999999999999876


No 242
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=45.58  E-value=12  Score=27.22  Aligned_cols=28  Identities=11%  Similarity=-0.044  Sum_probs=21.6

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      ..+..+..+|+..+|..||+...+.+.|
T Consensus       222 ~~~~~~i~~~l~~~p~~R~~~~~~~~~l  249 (260)
T cd05611         222 PEAVDLINRLLCMDPAKRLGANGYQEIK  249 (260)
T ss_pred             HHHHHHHHHHccCCHHHccCCCcHHHHH
Confidence            4466788899999999999876665544


No 243
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=43.06  E-value=27  Score=26.04  Aligned_cols=24  Identities=13%  Similarity=0.062  Sum_probs=20.3

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +.++-.+|+..+|.+||+..+++.
T Consensus       261 ~~dll~~mL~~dp~~R~t~~~~l~  284 (288)
T cd07871         261 GIDLLSSLLLYETKSRISAEAALR  284 (288)
T ss_pred             HHHHHHHhcCcCcccCCCHHHHhc
Confidence            456777999999999999999864


No 244
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=39.62  E-value=40  Score=29.48  Aligned_cols=36  Identities=25%  Similarity=0.460  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           24 NSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        24 ~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      ++-+.+-+|...|....+.+||.-.+++..|+.++.
T Consensus       620 ~~pk~mk~Ll~~C~~~~~~eRP~F~~il~~l~~l~~  655 (678)
T KOG0193|consen  620 NCPKAMKRLLSDCWKFDREERPLFPQLLSKLEELLP  655 (678)
T ss_pred             cCHHHHHHHHHHHHhcCcccCccHHHHHHHHHHhhh
Confidence            344556677789999999999999999998887665


No 245
>PHA03207 serine/threonine kinase US3; Provisional
Probab=38.71  E-value=28  Score=27.55  Aligned_cols=24  Identities=29%  Similarity=0.314  Sum_probs=19.9

Q ss_pred             HHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           30 AEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        30 ~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      ..+-.+|+..+|.+||++.+++..
T Consensus       352 ~~li~~ml~~dp~~Rpsa~e~l~~  375 (392)
T PHA03207        352 EYLIAKMLTFDQEFRPSAQDILSL  375 (392)
T ss_pred             HHHHHHHhccChhhCCCHHHHhhC
Confidence            345568999999999999998765


No 246
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=37.64  E-value=26  Score=25.01  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=17.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRD   49 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~   49 (127)
                      .+.++..+|+..+|..||++.+
T Consensus       219 ~l~~~i~~~l~~~p~~R~~~~~  240 (250)
T cd05123         219 EARDLISGLLQKDPTKRLGSGG  240 (250)
T ss_pred             HHHHHHHHHhcCCHhhCCCccc
Confidence            4456777899999999999954


No 247
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=37.51  E-value=29  Score=26.75  Aligned_cols=25  Identities=32%  Similarity=0.303  Sum_probs=21.1

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+...|++.+|..||+..+++..
T Consensus       276 ~~~li~~~L~~dp~~R~t~~e~l~h  300 (345)
T cd07877         276 AVDLLEKMLVLDSDKRITAAQALAH  300 (345)
T ss_pred             HHHHHHHHcCCChhhcCCHHHHhcC
Confidence            4567789999999999999888755


No 248
>PTZ00036 glycogen synthase kinase; Provisional
Probab=37.29  E-value=32  Score=27.86  Aligned_cols=26  Identities=15%  Similarity=0.092  Sum_probs=21.9

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      .+..+..+|+..+|..||+..+++..
T Consensus       326 ~~~~li~~~L~~dP~~R~ta~e~l~h  351 (440)
T PTZ00036        326 DAINFISQFLKYEPLKRLNPIEALAD  351 (440)
T ss_pred             HHHHHHHHHCCCChhHCcCHHHHhCC
Confidence            45677789999999999999998743


No 249
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=37.19  E-value=17  Score=26.90  Aligned_cols=27  Identities=22%  Similarity=0.168  Sum_probs=21.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      .+..+..+|++.+|.+||+..+++..+
T Consensus       225 ~~~~li~~~L~~~P~~R~~~~~~~~~~  251 (277)
T cd05607         225 ESKDICRLFLAKKPEDRLGSREKNDDP  251 (277)
T ss_pred             HHHHHHHHHhccCHhhCCCCccchhhh
Confidence            356677899999999999998776433


No 250
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=37.18  E-value=30  Score=26.00  Aligned_cols=30  Identities=13%  Similarity=0.117  Sum_probs=21.8

Q ss_pred             HHHHHHHHhhcCcCCCCCCCHHHHHHHHHH
Q 033105           27 RKFAEIAEKCLREDGDDRPTMRDVLWDLEY   56 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~   56 (127)
                      ..+.++..+|+..+|..||+....+..|..
T Consensus       259 ~~~~~li~~~l~~~p~~R~s~~~~~~~ll~  288 (316)
T cd05574         259 SSARDLIRKLLVKDPSKRLGSKRGAAEIKQ  288 (316)
T ss_pred             HHHHHHHHHHccCCHhHCCCchhhHHHHHc
Confidence            346667789999999999995555444443


No 251
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=35.85  E-value=35  Score=30.47  Aligned_cols=36  Identities=19%  Similarity=0.334  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           24 NSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        24 ~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      .|-.++.++-.+|-+-+|.+||+..++-+.+|.+.+
T Consensus       490 GCPpkVYeLMraCW~WsPsDRPsFaeiHqafEtmf~  525 (1157)
T KOG4278|consen  490 GCPPKVYELMRACWNWSPSDRPSFAEIHQAFETMFS  525 (1157)
T ss_pred             CCCHHHHHHHHHHhcCCcccCccHHHHHHHHHHHhc
Confidence            355678888899999999999999999999997654


No 252
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=35.08  E-value=30  Score=25.73  Aligned_cols=22  Identities=18%  Similarity=0.238  Sum_probs=17.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRD   49 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~   49 (127)
                      .+..+...|++.+|.+||++.+
T Consensus       231 ~~~~li~~~l~~~P~~R~~~~~  252 (285)
T cd05632         231 EAKSICKMLLTKDPKQRLGCQE  252 (285)
T ss_pred             HHHHHHHHHccCCHhHcCCCcc
Confidence            4567788999999999999543


No 253
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=35.06  E-value=32  Score=29.74  Aligned_cols=25  Identities=16%  Similarity=0.158  Sum_probs=21.0

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+..+|+..+|.+||++.+++..
T Consensus       610 ~~~~l~~lL~~dP~~R~ta~e~l~h  634 (669)
T cd05610         610 AQNAIEILLTMDPTKRAGLKELKQH  634 (669)
T ss_pred             HHHHHHHHcccChhHCcCHHHHHhC
Confidence            4556678999999999999999764


No 254
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=34.43  E-value=58  Score=29.16  Aligned_cols=39  Identities=18%  Similarity=0.301  Sum_probs=31.8

Q ss_pred             HHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           23 PNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        23 ~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      .+|=..+..|-..|=+.+|.+||+..++-..|+...+..
T Consensus       728 e~CP~~vY~LM~~CW~~~P~~RPsF~eI~~~L~~~~~~s  766 (774)
T KOG1026|consen  728 ENCPTEVYSLMLECWNENPKRRPSFKEIHSRLQAWAQAS  766 (774)
T ss_pred             CCCCHHHHHHHHHHhhcCcccCCCHHHHHHHHHHHHhcC
Confidence            344566777888999999999999999999998766543


No 255
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=33.13  E-value=39  Score=24.44  Aligned_cols=21  Identities=14%  Similarity=0.314  Sum_probs=17.4

Q ss_pred             HHHHHHHHhhcCcCCCCCCCH
Q 033105           27 RKFAEIAEKCLREDGDDRPTM   47 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM   47 (127)
                      ..+..+..+|+..+|.+||+|
T Consensus       221 ~~~~~~i~~~l~~~p~~R~~~  241 (262)
T cd05572         221 KAAKDLIKQLLRRNPEERLGN  241 (262)
T ss_pred             HHHHHHHHHHccCChhhCcCC
Confidence            355677789999999999994


No 256
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]
Probab=32.59  E-value=82  Score=28.21  Aligned_cols=40  Identities=23%  Similarity=0.337  Sum_probs=32.7

Q ss_pred             CHHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           22 SPNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        22 ~~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      +++|--.+.-+-.+|-+.+|.+||.-.++...|..+++..
T Consensus       614 P~nCPp~LYslmskcWayeP~kRPrftei~~~lsdv~qee  653 (974)
T KOG4257|consen  614 PPNCPPALYSLMSKCWAYEPSKRPRFTEIKAILSDVLQEE  653 (974)
T ss_pred             CCCCChHHHHHHHHHhccCcccCCcHHHHHHHHHHHHHHh
Confidence            4455556667788999999999999999999999888743


No 257
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=31.47  E-value=32  Score=25.59  Aligned_cols=25  Identities=20%  Similarity=0.094  Sum_probs=19.3

Q ss_pred             HHHHHHHhhcCcCCCCCC-----CHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRP-----TMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RP-----sM~~Vv~   52 (127)
                      .+..+...|+..+|.+||     +..++..
T Consensus       231 ~~~~li~~~l~~~P~~R~~~~~~~~~~l~~  260 (285)
T cd05605         231 AARSICRQLLTKDPGFRLGCRGEGAEEVKA  260 (285)
T ss_pred             HHHHHHHHHccCCHHHhcCCCCCCHHHHhc
Confidence            456678899999999999     5556533


No 258
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]
Probab=30.91  E-value=45  Score=30.07  Aligned_cols=33  Identities=24%  Similarity=0.381  Sum_probs=27.6

Q ss_pred             HHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           23 PNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        23 ~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      ..|-+.+..+...|-..+|.+||+-..+...+-
T Consensus       338 k~csedIY~imk~cWah~paDRptFsair~~~~  370 (1039)
T KOG0199|consen  338 KYCSEDIYQIMKNCWAHNPADRPTFSAIREDLV  370 (1039)
T ss_pred             CCChHHHHHHHHHhccCCccccccHHHHHHhHH
Confidence            346677888999999999999999999975544


No 259
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=30.28  E-value=47  Score=25.29  Aligned_cols=25  Identities=8%  Similarity=0.105  Sum_probs=20.1

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWD   53 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~   53 (127)
                      +..+..+|+...|.+||++.+++..
T Consensus       233 ~~~li~~~l~~~~~rr~s~~~ll~h  257 (333)
T cd05600         233 AWDLITKLINDPSRRFGSLEDIKNH  257 (333)
T ss_pred             HHHHHHHHhhChhhhcCCHHHHHhC
Confidence            4456668999999999999998753


No 260
>PHA03210 serine/threonine kinase US3; Provisional
Probab=28.73  E-value=57  Score=27.02  Aligned_cols=23  Identities=26%  Similarity=0.085  Sum_probs=19.5

Q ss_pred             HHHHHhhcCcCCCCCCCHHHHHH
Q 033105           30 AEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        30 ~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ..+-.+|+..+|.+||+..+++.
T Consensus       431 ~~li~kmL~~DP~~Rpsa~elL~  453 (501)
T PHA03210        431 EYPLVKMLTFDWHLRPGAAELLA  453 (501)
T ss_pred             HHHHHHHhccCcccCcCHHHHhh
Confidence            34456899999999999999975


No 261
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=28.66  E-value=37  Score=25.82  Aligned_cols=25  Identities=16%  Similarity=0.194  Sum_probs=19.8

Q ss_pred             HHHHHHHhhcCcCCCCCCCH-----HHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTM-----RDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM-----~~Vv~   52 (127)
                      .+..+..+|++.+|.+||+.     .+++.
T Consensus       222 ~~~~li~~~l~~dP~~R~s~~~~~~~~ll~  251 (318)
T cd05570         222 EAKSILKSFLTKNPEKRLGCLPTGEQDIKG  251 (318)
T ss_pred             HHHHHHHHHccCCHHHcCCCCCCCHHHHhc
Confidence            34567779999999999998     66643


No 262
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=28.60  E-value=53  Score=27.93  Aligned_cols=22  Identities=23%  Similarity=0.345  Sum_probs=19.5

Q ss_pred             HHHHhhcCcCCCCCCCHHHHHH
Q 033105           31 EIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        31 ~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      ++-.+|++.+|.+||+..+++.
T Consensus       428 dLi~~mL~~dP~kR~ta~e~L~  449 (566)
T PLN03225        428 ELLKSMMRFKGRQRISAKAALA  449 (566)
T ss_pred             HHHHHHccCCcccCCCHHHHhC
Confidence            5778999999999999998875


No 263
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms]
Probab=28.59  E-value=55  Score=27.65  Aligned_cols=33  Identities=15%  Similarity=0.261  Sum_probs=27.6

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHh
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLWDLEYALQL   60 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~   60 (127)
                      .++.+...|-.+.|..||++..|-..++.+...
T Consensus       195 ~l~~l~~~cw~e~P~~rPs~~~i~~~~~~~~~~  227 (484)
T KOG1023|consen  195 ELLLLVARCWEEIPEKRPSIEQIRSKLLTINKG  227 (484)
T ss_pred             HHHHHHHHhcccChhhCccHHHHHhhhhhhccc
Confidence            577788899999999999999998877765543


No 264
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=28.51  E-value=38  Score=25.13  Aligned_cols=25  Identities=16%  Similarity=0.102  Sum_probs=19.2

Q ss_pred             HHHHHHHhhcCcCCCCCCC-----HHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPT-----MRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPs-----M~~Vv~   52 (127)
                      .+..+..+|+..+|.+||+     +.++..
T Consensus       231 ~~~~li~~~l~~~P~~R~~~~~~~~~~~~~  260 (285)
T cd05631         231 DAKSICRMLLTKNPKERLGCRGNGAAGVKQ  260 (285)
T ss_pred             HHHHHHHHHhhcCHHHhcCCCCCCHHHHhc
Confidence            4556778999999999997     566654


No 265
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=27.44  E-value=57  Score=27.38  Aligned_cols=24  Identities=33%  Similarity=0.702  Sum_probs=19.4

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      |-++...|+..+|..||+-.+.++
T Consensus       239 ~kEFV~~CL~k~P~~RpsA~~LLK  262 (467)
T KOG0201|consen  239 FKEFVEACLDKNPEFRPSAKELLK  262 (467)
T ss_pred             HHHHHHHHhhcCcccCcCHHHHhh
Confidence            445566899999999999888754


No 266
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=26.84  E-value=50  Score=24.42  Aligned_cols=25  Identities=16%  Similarity=0.117  Sum_probs=18.7

Q ss_pred             HHHHHHHhhcCcCCCCCC-----CHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRP-----TMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RP-----sM~~Vv~   52 (127)
                      .+..+..+|++.+|.+||     ++.+++.
T Consensus       227 ~~~~li~~~l~~~P~~R~~~~~~~~~~~l~  256 (280)
T cd05608         227 ASKSFCEALLAKDPEKRLGFRDGNCDGLRT  256 (280)
T ss_pred             HHHHHHHHHhcCCHHHhcCCCCCCHHHHhc
Confidence            355677899999999999     5555553


No 267
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]
Probab=26.32  E-value=80  Score=28.77  Aligned_cols=41  Identities=12%  Similarity=0.288  Sum_probs=34.8

Q ss_pred             CCHHHHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHHhh
Q 033105           21 ISPNSLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQLQ   61 (127)
Q Consensus        21 ~~~~~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~~~   61 (127)
                      .+++|=..+-.+.+.|=+.+..+||.-.+++..|..+..-.
T Consensus       855 pPmDCP~aL~qLMldCWqkdR~~RP~F~qiV~~lDklIrnP  895 (996)
T KOG0196|consen  855 PPMDCPAALYQLMLDCWQKDRNRRPKFAQIVSTLDKLIRNP  895 (996)
T ss_pred             CCCCCcHHHHHHHHHHHHHHhhcCCCHHHHHHHHHHHhcCc
Confidence            44567778888999999999999999999999999876543


No 268
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]
Probab=25.59  E-value=1.1e+02  Score=25.85  Aligned_cols=35  Identities=29%  Similarity=0.409  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHHH
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYALQ   59 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~~   59 (127)
                      |=..+.+|-..|-+.+|.+||+-....+.|+.+..
T Consensus       429 CP~~vY~lM~~CW~~~P~~RPtF~~L~~~l~~~~~  463 (468)
T KOG0197|consen  429 CPDEVYELMKSCWHEDPEDRPTFETLREVLEDFFT  463 (468)
T ss_pred             CCHHHHHHHHHHhhCCcccCCCHHHHHHHHHHhhh
Confidence            33456667789999999999999988888877654


No 269
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]
Probab=25.15  E-value=60  Score=26.36  Aligned_cols=25  Identities=32%  Similarity=0.611  Sum_probs=21.7

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      -++.+.-.|+..+|.+|++..+.+.
T Consensus       259 ~~ld~~k~cL~~dP~~R~sc~qll~  283 (396)
T KOG0593|consen  259 VLLDLLKKCLKMDPDDRLSCEQLLH  283 (396)
T ss_pred             HHHHHHHHHhcCCccccccHHHHhc
Confidence            4677888999999999999999764


No 270
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=24.44  E-value=61  Score=23.31  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=17.3

Q ss_pred             HHHHHHHHhhcCcCCCCCCCH
Q 033105           27 RKFAEIAEKCLREDGDDRPTM   47 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPsM   47 (127)
                      ..+..+..+|+..+|.+||+.
T Consensus       227 ~~~~~~i~~~l~~~p~~R~~~  247 (258)
T cd05578         227 TEAIDAINKLLERDPQKRLGD  247 (258)
T ss_pred             HHHHHHHHHHccCChhHcCCc
Confidence            445567788999999999998


No 271
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=24.24  E-value=97  Score=28.40  Aligned_cols=34  Identities=32%  Similarity=0.329  Sum_probs=26.3

Q ss_pred             HHHHHHHhhcCcCCCCCC-CHHHHHHHHHHHHHhh
Q 033105           28 KFAEIAEKCLREDGDDRP-TMRDVLWDLEYALQLQ   61 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RP-sM~~Vv~~Le~~~~~~   61 (127)
                      .+..+..+|++.+|.+|| ++.++...|+...+-.
T Consensus       260 ~L~~LI~rcL~~DP~kR~ss~eeLl~~Le~~lq~~  294 (932)
T PRK13184        260 FLSQIAMKALAVDPAERYSSVQELKQDLEPHLQGS  294 (932)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHHHHHHhcC
Confidence            356788899999999995 6777778888766543


No 272
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=23.01  E-value=38  Score=25.59  Aligned_cols=26  Identities=12%  Similarity=-0.085  Sum_probs=18.6

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWDL   54 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~L   54 (127)
                      +.++..+|+..+|.+||+...+...|
T Consensus       220 ~~~li~~~L~~dp~~R~~~~~~~e~l  245 (312)
T cd05585         220 AKDLLIGLLSRDPTRRLGYNGAQEIK  245 (312)
T ss_pred             HHHHHHHHcCCCHHHcCCCCCHHHHH
Confidence            45667799999999998754443333


No 273
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=22.89  E-value=63  Score=24.74  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=16.5

Q ss_pred             HHHHHHHHhhcCcCCCCCCC
Q 033105           27 RKFAEIAEKCLREDGDDRPT   46 (127)
Q Consensus        27 ~~~~~la~~Cl~~~p~~RPs   46 (127)
                      ..+..+..+|++.+|..||+
T Consensus       230 ~~~~~ll~~~L~~dP~~R~~  249 (329)
T cd05618         230 VKAASVLKSFLNKDPKERLG  249 (329)
T ss_pred             HHHHHHHHHHhcCCHHHcCC
Confidence            34556778999999999998


No 274
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]
Probab=22.70  E-value=88  Score=25.49  Aligned_cols=24  Identities=33%  Similarity=0.731  Sum_probs=19.2

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      |..+.-.|++.+|.+||+-.+.+.
T Consensus       311 f~~FV~~CL~Kdp~~R~s~~qLl~  334 (364)
T KOG0581|consen  311 FRSFVSCCLRKDPSERPSAKQLLQ  334 (364)
T ss_pred             HHHHHHHHhcCCcccCCCHHHHhc
Confidence            444556899999999999888754


No 275
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=22.51  E-value=87  Score=26.56  Aligned_cols=25  Identities=36%  Similarity=0.603  Sum_probs=20.3

Q ss_pred             HHHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      .|-+....|+..+|..||+-.+.+.
T Consensus       268 sf~e~i~~CL~kDP~kRptAskLlk  292 (516)
T KOG0582|consen  268 SFREMIALCLVKDPSKRPTASKLLK  292 (516)
T ss_pred             HHHHHHHHHhhcCcccCCCHHHHhc
Confidence            4556677899999999999988753


No 276
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]
Probab=22.36  E-value=1.6e+02  Score=25.30  Aligned_cols=34  Identities=24%  Similarity=0.433  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHHH
Q 033105           25 SLRKFAEIAEKCLREDGDDRPTMRDVLWDLEYAL   58 (127)
Q Consensus        25 ~l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~~   58 (127)
                      |-..+..+...|=+.+|.+||+-.+.+..|+..+
T Consensus       547 c~~eiY~iM~~CW~~~p~~RP~F~~~~~~~~~~l  580 (609)
T KOG0200|consen  547 CSDEIYDLMKSCWNADPEDRPTFSECVEFFEKHL  580 (609)
T ss_pred             CCHHHHHHHHHHhCCCcccCCCHHHHHHHHHHHH
Confidence            4556678888999999999999999999999853


No 277
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=22.30  E-value=71  Score=24.12  Aligned_cols=21  Identities=5%  Similarity=0.071  Sum_probs=16.7

Q ss_pred             HHHHHHhhcCcCCCCCCCHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRD   49 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~   49 (127)
                      +..+..+|++.+|.+||++.+
T Consensus       225 ~~~li~~~l~~~P~~R~~a~~  245 (318)
T cd05582         225 AQSLLRALFKRNPANRLGAGP  245 (318)
T ss_pred             HHHHHHHHhhcCHhHcCCCCC
Confidence            445667999999999999544


No 278
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=21.83  E-value=56  Score=24.28  Aligned_cols=24  Identities=21%  Similarity=0.185  Sum_probs=19.2

Q ss_pred             HHHHHHhhcCcCCCCCCC-----HHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPT-----MRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPs-----M~~Vv~   52 (127)
                      +..+...|++.+|..||+     ..+++.
T Consensus       232 ~~~li~~~l~~~p~~R~s~~~~~~~~~~~  260 (285)
T cd05630         232 ARSLCKMLLCKDPKERLGCQGGGAREVKE  260 (285)
T ss_pred             HHHHHHHHhhcCHHHccCCCCCchHHHHc
Confidence            456777899999999998     666665


No 279
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=21.67  E-value=90  Score=22.57  Aligned_cols=23  Identities=13%  Similarity=0.339  Sum_probs=15.2

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLW   52 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~   52 (127)
                      +..+-.+|+. +|..||++.+++.
T Consensus       238 ~~~~i~~~l~-~p~~Rp~~~~il~  260 (265)
T cd06652         238 CRDFLKRIFV-EAKLRPSADELLR  260 (265)
T ss_pred             HHHHHHHHhc-ChhhCCCHHHHhc
Confidence            3344445653 7888999888764


No 280
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=20.78  E-value=71  Score=24.24  Aligned_cols=23  Identities=13%  Similarity=0.127  Sum_probs=18.1

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVL   51 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv   51 (127)
                      +..+..+|+..+|.+||++.+.+
T Consensus       223 ~~~ll~~~l~~~P~~R~~~~~~l  245 (316)
T cd05592         223 AKDCLSKLFERDPTKRLGVDGDI  245 (316)
T ss_pred             HHHHHHHHccCCHHHcCCChHHH
Confidence            45566799999999999986443


No 281
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=20.33  E-value=71  Score=23.61  Aligned_cols=25  Identities=20%  Similarity=0.211  Sum_probs=19.0

Q ss_pred             HHHHHHHhhcCcCCCCCC-----CHHHHHH
Q 033105           28 KFAEIAEKCLREDGDDRP-----TMRDVLW   52 (127)
Q Consensus        28 ~~~~la~~Cl~~~p~~RP-----sM~~Vv~   52 (127)
                      .+..+-..|+..+|.+||     ++.+++.
T Consensus       225 ~~~~li~~~l~~~p~~R~~~~~~~~~~~~~  254 (279)
T cd05633         225 ELKSLLEGLLQRDVSKRLGCLGRGAQEVKE  254 (279)
T ss_pred             HHHHHHHHHhcCCHHHhcCCCCCCHHHHHh
Confidence            344556789999999999     5777755


No 282
>PF00440 TetR_N:  Bacterial regulatory proteins, tetR family;  InterPro: IPR001647 This entry represents a DNA-binding domain with a helix-turn-helix (HTH) structure that is found in several bacterial and archaeal transcriptional regulators, such as TetR, the tetracycline resistance repressor. Numerous other transcriptional regulatory proteins also contain HTH-type DNA-binding domains, and can be grouped into subfamiles based on sequence similarity. The domain represented by this entry is found in a subfamily of proteins that includes the transcriptional regulators TetR, TetC, AcrR, BetI, Bm3R1, EnvR, QacR, MtrR, TcmR, Ttk, YbiH, and YhgD [, , ]. Many of these proteins function as repressors that control the level of susceptibility to hydrophobic antibiotics and detergents. They all have similar molecular weights, ranging from 21 to 25 kDa. The helix-turn-helix motif is located in the initial third of the protein. The 3D structure of the homodimeric TetR protein complexed with 7-chloro-tetracycline-magnesium has been determined to 2.1 A resolution []. TetR folds into ten alpha-helices with connecting turns and loops. The three N-terminal alpha-helices of the repressor form the DNA-binding domain: this structural motif encompasses an HTH fold with an inverse orientation compared with that of other DNA-binding proteins.; GO: 0003677 DNA binding; PDB: 3NPI_B 3IUV_A 3CCY_A 2JK3_A 2FX0_A 2JJ7_A 2WV1_B 3BTI_D 3BR6_E 3BR5_A ....
Probab=20.20  E-value=55  Score=17.80  Aligned_cols=27  Identities=22%  Similarity=0.284  Sum_probs=20.9

Q ss_pred             HHHHHHhhcCcCCCCCCCHHHHHHHHH
Q 033105           29 FAEIAEKCLREDGDDRPTMRDVLWDLE   55 (127)
Q Consensus        29 ~~~la~~Cl~~~p~~RPsM~~Vv~~Le   55 (127)
                      +++.|..|....+-..-+|.+|...+.
T Consensus         1 Il~aa~~l~~~~G~~~~s~~~Ia~~~g   27 (47)
T PF00440_consen    1 ILEAALELFAEKGYEAVSIRDIARRAG   27 (47)
T ss_dssp             HHHHHHHHHHHHHTTTSSHHHHHHHHT
T ss_pred             CHHHHHHHHHHhCHHhCCHHHHHHHHc
Confidence            356677777778888899999988764


No 283
>PF07524 Bromo_TP:  Bromodomain associated;  InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO). The tandem PHD finger-bromodomain is found in many chromatin-associated proteins. It is involved in gene silencing by the human co-repressor KRAB-associated protein 1 (KAP1). The tandem PHD finger-bromodomain of KAP1 has a distinct structure that joins the two protein modules. The first helix, alpha(Z), of an atypical bromodomain forms the central hydrophobic core that anchors the other three helices of the bromodomain on one side and the zinc binding PHD finger on the other [].  The Rap1 GTPase-activating protein, Sipa1, is modulated by the cellular bromodomain protein, Brd4. Brd4 belongs to the BET family and is a multifunctional protein involved in transcription, replication, the signal transduction pathway, and cell cycle progression. All of these functions are linked to its association with acetylated chromatin. It has tandem bromodomains []. The dysregulation of the Brd4-associated pathways may play an important role in breast cancer progression []. Bovine papillomavirus type 1 E2 also binds to chromosomes in a complex with Brd4. Interaction with Brd4 is additionally important for E2-mediated transcriptional regulation [, ]. 
Probab=20.09  E-value=2.1e+02  Score=17.21  Aligned_cols=32  Identities=25%  Similarity=0.415  Sum_probs=23.3

Q ss_pred             HHHHHHHHHhhcCcCCCCCCCHHHHHHHHHHH
Q 033105           26 LRKFAEIAEKCLREDGDDRPTMRDVLWDLEYA   57 (127)
Q Consensus        26 l~~~~~la~~Cl~~~p~~RPsM~~Vv~~Le~~   57 (127)
                      +.++...+.......++..|+..||...|+..
T Consensus        40 l~~l~~~~~~~ae~~gRt~~~~~Dv~~al~~~   71 (77)
T PF07524_consen   40 LQELGRTAKRYAEHAGRTEPNLQDVEQALEEM   71 (77)
T ss_pred             HHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHh
Confidence            45555555555677788899999999888754


Done!