Citrus Sinensis ID: 033115

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MIICCVKLRVTISQLPLSSATTAAFGPRVKTSLRFFLLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
cEEEEEcEEEEcccccCEEEEEEccccEEEEEcccccccHHHHHHHHHHcccccccccccEEEccEEEEEEEccccCEEEEEcccccEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHccc
MIICCVKLRVTISQLPLSSATTAAFGPRVKTSLRFFLLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIICCVKLRVTISQLPLSSATTAAFGPRVKTSLRFFLLKPEEITGIMNDFNEPGTLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Profilin-1 Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.confidentO65809
Profilin LP04 Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.probableP83647
Profilin-1 Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.probableP49231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NUL, chain A
Confidence level:very confident
Coverage over the Query: 15-127
View the alignment between query and template
View the model in PyMOL