Citrus Sinensis ID: 033139

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------

MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDQLMVVVANPRQFKIPDWFLNRQKDYKDGRYSQVVSNALDMKLRDDLERLKKIRYGLVVLLL

cccccccccHHHHEEccccccccEEEEEEEcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc

*****NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDQLMVVVANPRQFKIPDWFLNRQKDYKDGRYSQVVSNALDMKLRDDLERLKKIRYGLVVLLL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDQLMVVVANPRQFKIPDWFLNRQKDYKDGRYSQVVSNALDMKLRDDLERLKKIRYGLVVLLL

Annotation	Function Description	Confidence Level	Reference Protein
40S ribosomal protein S18	Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.	confident	P34788
40S ribosomal protein S18-A	Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.	probable	P0CX55
40S ribosomal protein S18-B	Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.	probable	P0CX56

No EC number assigned to the protein, probably not an enzyme!

Template: 3IZ6, chain M
Confidence level:very confident
Coverage over the Query: 1-123
View the alignment between query and template
View the model in PyMOL