BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033141
         (126 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human
           Transcriptional Protein Dpf3 Bound To A Histone Peptide
           Containing Acetylation At Lysine 14
 pdb|2KWK|A Chain A, Solution Structures Of The Double Phd Fingers Of Human
           Transcriptional Protein Dpf3b Bound To A H3 Peptide Wild
           Type
 pdb|2KWN|A Chain A, Solution Structure Of The Double Phd (Plant Homeodomain)
           Fingers Of Human Transcriptional Protein Dpf3b Bound To
           A Histone H4 Peptide Containing Acetylation At Lysine 16
 pdb|2KWO|A Chain A, Solution Structure Of The Double Phd (Plant Homeodomain)
           Fingers Of Human Transcriptional Protein Dpf3b Bound To
           A Histone H4 Peptide Containing N-Terminal Acetylation
           At Serine 1
          Length = 114

 Score = 25.4 bits (54), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 22/51 (43%)

Query: 65  VVCADCDGNGAVLCSQCKGSGVNAVDFFGGQFKAGDSCWLCGQSSQHFSLI 115
           V CADC  +G   C Q   +   AV  +  Q     SC LCG S     L+
Sbjct: 24  VSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLL 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.128    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,732,175
Number of Sequences: 62578
Number of extensions: 139024
Number of successful extensions: 279
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 278
Number of HSP's gapped (non-prelim): 2
length of query: 126
length of database: 14,973,337
effective HSP length: 87
effective length of query: 39
effective length of database: 9,529,051
effective search space: 371632989
effective search space used: 371632989
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)