Citrus Sinensis ID: 033157
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| 18073986 | 570 | zeta-carotene desaturase [Citrus sinensi | 1.0 | 0.221 | 0.936 | 3e-62 | |
| 83637848 | 570 | zeta-carotene desaturase [Citrus unshiu] | 1.0 | 0.221 | 0.936 | 3e-62 | |
| 13991921 | 570 | zeta-carotene desaturase precursor [Citr | 1.0 | 0.221 | 0.936 | 3e-62 | |
| 15824043 | 570 | zeta-carotene desaturase [Citrus unshiu] | 1.0 | 0.221 | 0.936 | 3e-62 | |
| 190576747 | 570 | zeta carotene desaturase [Citrus maxima] | 1.0 | 0.221 | 0.928 | 1e-61 | |
| 197318637 | 299 | zeta carotene desaturase [Citrus maxima] | 1.0 | 0.421 | 0.912 | 3e-59 | |
| 33313474 | 571 | zeta-carotene desaturase ZDS2 [Malus x d | 0.992 | 0.218 | 0.809 | 5e-50 | |
| 33313470 | 568 | zeta-carotene desaturase ZDS1 [Malus x d | 0.992 | 0.220 | 0.809 | 5e-50 | |
| 1583601 | 588 | zeta carotene desaturase | 0.992 | 0.212 | 0.785 | 1e-49 | |
| 356535151 | 570 | PREDICTED: zeta-carotene desaturase, chl | 0.984 | 0.217 | 0.793 | 1e-49 |
| >gi|18073986|emb|CAC85667.1| zeta-carotene desaturase [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 243 bits (619), Expect = 3e-62, Method: Compositional matrix adjust.
Identities = 118/126 (93%), Positives = 120/126 (95%)
Query: 1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLY EGPGKDPFRPDQKT VKN
Sbjct: 445 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYREGPGKDPFRPDQKTPVKN 504
Query: 61 LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTN 120
FLAGSYTKQDYID MEGA+LSGRQASAYICNA EELVALRKQLAAFESQEQME PTTTN
Sbjct: 505 FFLAGSYTKQDYIDSMEGATLSGRQASAYICNAGEELVALRKQLAAFESQEQMEAPTTTN 564
Query: 121 DDLSLV 126
D+LSLV
Sbjct: 565 DELSLV 570
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|83637848|gb|ABC33728.1| zeta-carotene desaturase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|13991921|gb|AAK51557.1|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi] | Back alignment and taxonomy information |
|---|
| >gi|15824043|dbj|BAB68552.1| zeta-carotene desaturase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|190576747|gb|ACE79169.1| zeta carotene desaturase [Citrus maxima] | Back alignment and taxonomy information |
|---|
| >gi|197318637|gb|ACH67607.1| zeta carotene desaturase [Citrus maxima] | Back alignment and taxonomy information |
|---|
| >gi|33313474|gb|AAQ04225.1| zeta-carotene desaturase ZDS2 [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|33313470|gb|AAQ04224.1| zeta-carotene desaturase ZDS1 [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|1583601|prf||2121278A zeta carotene desaturase | Back alignment and taxonomy information |
|---|
| >gi|356535151|ref|XP_003536112.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| TAIR|locus:2114789 | 558 | ZDS "zeta-carotene desaturase" | 0.936 | 0.211 | 0.690 | 9.9e-39 | |
| TAIR|locus:2129515 | 566 | PDS3 "phytoene desaturase 3" [ | 0.753 | 0.167 | 0.37 | 1.2e-08 |
| TAIR|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 414 (150.8 bits), Expect = 9.9e-39, P = 9.9e-39
Identities = 87/126 (69%), Positives = 97/126 (76%)
Query: 1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
M +PND+II +VA QV LFPSS+GLEV WSSVVKI QSLY E PGKDPFRPDQKT +KN
Sbjct: 441 MRMPNDKIIEKVAMQVTELFPSSRGLEVTWSSVVKIAQSLYREAPGKDPFRPDQKTPIKN 500
Query: 61 LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTN 120
FLAGSYTKQDYID MEGA+LSGRQAS+YIC+A EEL L K+L S VP
Sbjct: 501 FFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKL----SSSATAVP---- 552
Query: 121 DDLSLV 126
D+LSLV
Sbjct: 553 DELSLV 558
|
|
| TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 1e-63 | |
| TIGR02732 | 474 | TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot | 2e-50 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 2e-22 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 9e-19 | |
| TIGR03467 | 411 | TIGR03467, HpnE, squalene-associated FAD-dependent | 9e-16 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 4e-15 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 1e-10 |
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
Score = 202 bits (516), Expect = 1e-63
Identities = 84/109 (77%), Positives = 92/109 (84%)
Query: 1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
MPL ND+I+ +V KQVL LFPSS+GLEV WSSVVKIGQSLY E PG DPFRPDQKT + N
Sbjct: 460 MPLSNDKIVEKVHKQVLELFPSSRGLEVTWSSVVKIGQSLYREAPGMDPFRPDQKTPISN 519
Query: 61 LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFES 109
FLAGSYTKQDYID MEGA+LSGRQA+AYIC A EEL LRK+LAA ES
Sbjct: 520 FFLAGSYTKQDYIDSMEGATLSGRQAAAYICEAGEELAGLRKKLAAEES 568
|
Length = 569 |
| >gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| PLN02487 | 569 | zeta-carotene desaturase | 99.87 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.83 | |
| PLN02612 | 567 | phytoene desaturase | 99.72 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.7 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.67 | |
| PLN02268 | 435 | probable polyamine oxidase | 99.59 | |
| PLN02676 | 487 | polyamine oxidase | 99.55 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.52 | |
| PLN02568 | 539 | polyamine oxidase | 99.45 | |
| PLN03000 | 881 | amine oxidase | 99.45 | |
| PLN02976 | 1713 | amine oxidase | 99.45 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 99.41 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 99.37 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 99.36 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 99.28 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 99.2 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.1 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.03 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.02 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.01 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 98.96 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 98.77 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 98.73 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 98.34 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 98.21 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 98.16 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 98.15 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 97.95 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 96.48 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 96.18 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 93.76 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 93.72 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 93.37 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 92.8 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 92.53 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 92.28 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 92.27 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 92.19 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 92.04 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 91.41 | |
| PLN02661 | 357 | Putative thiazole synthesis | 91.36 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 90.69 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 90.66 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 90.52 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 90.52 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 90.23 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 90.0 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 89.95 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 89.93 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 89.82 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 89.74 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 89.39 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 89.35 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 89.11 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 88.99 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 88.83 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 88.65 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 88.38 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 88.21 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 87.83 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 87.77 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 87.46 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 87.34 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 87.08 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 86.99 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 86.92 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 86.49 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 86.26 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 86.26 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 85.86 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 85.7 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 85.63 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 85.61 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 85.58 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 85.42 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 85.34 | |
| PRK06116 | 450 | glutathione reductase; Validated | 85.33 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 85.09 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 84.95 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 84.88 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 84.57 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 84.41 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 84.37 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 84.32 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 84.07 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 83.98 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 83.98 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 83.93 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 83.44 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 83.42 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 83.35 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 83.33 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 83.25 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 82.54 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 82.38 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 82.3 | |
| PLN02815 | 594 | L-aspartate oxidase | 82.29 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 82.22 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 82.19 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 82.15 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 82.08 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 81.96 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 81.77 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 81.65 | |
| PRK07121 | 492 | hypothetical protein; Validated | 81.5 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 81.24 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 80.9 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 80.79 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 80.79 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 80.77 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 80.62 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 80.59 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 80.51 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 80.44 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 80.38 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 80.34 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 80.33 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 80.14 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 80.14 |
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
Probab=99.87 E-value=6.2e-22 Score=169.75 Aligned_cols=108 Identities=77% Similarity=1.178 Sum_probs=101.0
Q ss_pred CCCCHHHHHHHHHHHHHHhCCCCCCCCeeEEEEEEeCCccccCCCCCCCCCCCCCCCCCCEEEccccccCCCCCcHHHHH
Q 033157 1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGAS 80 (126)
Q Consensus 1 ~~~sdeel~~~vl~~L~~~fp~~~~~~~~~~~v~r~~~a~~~~~pG~~~~rp~~~tp~~~L~lAGd~t~~~~patmeGAv 80 (126)
+.+++++|+++++++|.++||.+....+.+++++++++++|.+.||....||..+||++|||+|||||++.||+|||||+
T Consensus 460 ~~~~~~ei~~~~~~~L~~~~p~~~~~~v~~~~vv~~~~at~~~~pg~~~~RP~~~T~~~nl~LAGD~t~~~yPat~EgAv 539 (569)
T PLN02487 460 MPLSNDKIVEKVHKQVLELFPSSRGLEVTWSSVVKIGQSLYREAPGMDPFRPDQKTPISNFFLAGSYTKQDYIDSMEGAT 539 (569)
T ss_pred cCCCHHHHHHHHHHHHHHhCcccccCceEEEEEEEccCceeccCCCccccCCCCCCCCCCEEEeCcccccCCcchHHHHH
Confidence 46899999999999999999987656788999999999999999999888999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhhHHHHHHHHHHhh
Q 033157 81 LSGRQASAYICNAREELVALRKQLAAFE 108 (126)
Q Consensus 81 ~SG~~AA~~Il~~~~~~~~~~~~~~~~~ 108 (126)
+||++||+.|++..+.+..+++++...+
T Consensus 540 ~SG~~AA~~i~~~~~~~~~~~~~~~~~~ 567 (569)
T PLN02487 540 LSGRQAAAYICEAGEELAGLRKKLAAEE 567 (569)
T ss_pred HHHHHHHHHHHHHhhhhhhhhhhhhccc
Confidence 9999999999999999999999987653
|
|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 6e-05 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 8e-05 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 4e-04 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 5e-04 |
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
Score = 40.0 bits (94), Expect = 6e-05
Identities = 15/93 (16%), Positives = 35/93 (37%), Gaps = 11/93 (11%)
Query: 1 MPLPNDEI---IRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQ 57
M L N + I + +++L +FP E + + V + G + G +
Sbjct: 319 MALKNGNVKKAIEKGWEELLEIFP---EGEPLLAQVYRDGNPVNRTRAG-----LHIEWP 370
Query: 58 VKNLFLAGSYTKQDYIDIMEGASLSGRQASAYI 90
+ + + G + ++G +L +A +
Sbjct: 371 LNEVLVVGDGYRPPGGIEVDGIALGVMKALEKL 403
|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.58 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 99.5 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 99.5 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 99.48 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 99.46 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.43 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 99.42 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 99.41 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 99.4 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.32 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.31 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.25 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 99.23 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.21 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.18 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.15 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 99.14 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 98.95 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 98.95 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.92 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 98.88 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 98.77 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.65 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 98.64 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 98.12 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 98.07 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 97.83 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 96.88 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 95.84 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 95.72 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 95.58 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 95.2 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 95.2 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 94.77 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 94.33 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 94.25 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 94.24 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 94.21 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 94.21 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 94.16 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 93.94 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 93.8 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 93.8 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 93.78 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 93.69 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 93.66 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 93.51 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 93.49 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 93.17 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 92.7 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 92.7 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 92.64 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 92.47 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 92.34 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 91.57 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 91.39 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 91.16 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 90.73 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 90.35 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 89.74 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 89.28 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 89.22 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 89.22 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 88.49 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 88.35 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 87.96 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 87.93 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 87.76 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 87.73 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 87.04 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 86.72 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 86.63 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 86.59 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 86.53 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 86.46 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 86.45 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 86.34 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 86.09 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 86.03 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 85.95 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 85.76 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 85.42 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 85.42 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 85.07 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 85.03 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 84.99 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 84.78 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 84.73 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 84.6 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 84.5 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 84.3 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 84.16 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 83.64 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 83.53 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 83.45 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 83.36 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 83.3 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 83.21 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 82.87 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 82.75 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 82.71 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 82.5 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 82.41 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 82.38 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 82.27 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 82.14 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 81.87 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 81.77 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 81.45 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 81.27 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 81.24 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 81.22 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 80.98 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 80.75 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 80.74 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 80.66 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 80.18 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 80.14 |
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
Probab=99.58 E-value=2e-16 Score=116.76 Aligned_cols=93 Identities=12% Similarity=0.032 Sum_probs=73.3
Q ss_pred CCCHHHHHHHHHHHHHHhCCCCCCCCeeEE--EEEEeCC-----ccccC-CCCCC-CCCCCCCCCCCCEEEccccccCCC
Q 033157 2 PLPNDEIIRRVAKQVLALFPSSQGLEVIWS--SVVKIGQ-----SLYHE-GPGKD-PFRPDQKTQVKNLFLAGSYTKQDY 72 (126)
Q Consensus 2 ~~sdeel~~~vl~~L~~~fp~~~~~~~~~~--~v~r~~~-----a~~~~-~pG~~-~~rp~~~tp~~~L~lAGd~t~~~~ 72 (126)
.++++++++.++++|+++|+... ..+..+ .+++|.. +.|++ .||.. ..++.++.|.++||||||+|+. |
T Consensus 53 ~l~~~e~~~~~l~~L~~~~g~~~-~~~~~~~~~~~~W~~dp~~~Ga~s~~~pg~~~~~~~~l~~p~grl~FAGe~ts~-~ 130 (181)
T 2e1m_C 53 SFDDAERYGYALENLQSVHGRRI-EVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSL-K 130 (181)
T ss_dssp TSCTTTTHHHHHHHHHHHHCGGG-GGTEEEEEEEEESSSCTTTSSSEECCCTTHHHHHHHHHHSCBTTEEECSGGGTT-S
T ss_pred cCCHHHHHHHHHHHHHHHhCCCc-HhhccCcceecccCCCCCCCCcccCcCCCchHHHHHHHhCCCCcEEEEEHHHcC-C
Confidence 46889999999999999994332 345567 8899965 44443 56643 2345667788999999999996 9
Q ss_pred CCcHHHHHHHHHHHHHHHHHHHhh
Q 033157 73 IDIMEGASLSGRQASAYICNAREE 96 (126)
Q Consensus 73 patmeGAv~SG~~AA~~Il~~~~~ 96 (126)
+++||||+.||++||++|++.+..
T Consensus 131 ~g~~eGAl~SG~raA~~i~~~l~~ 154 (181)
T 2e1m_C 131 HAWIEGAVETAVRAAIAVNEAPVG 154 (181)
T ss_dssp TTSHHHHHHHHHHHHHHHHTCCC-
T ss_pred ccCHHHHHHHHHHHHHHHHHHhcc
Confidence 999999999999999999987654
|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 126 | ||||
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 9e-12 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 9e-05 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 58.4 bits (139), Expect = 9e-12
Identities = 15/64 (23%), Positives = 25/64 (39%)
Query: 30 WSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAY 89
+ L + P P + LF AG +T ++Y + GA LSG + +
Sbjct: 383 AAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGR 442
Query: 90 ICNA 93
I +
Sbjct: 443 IADQ 446
|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.38 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 98.66 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.91 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 97.89 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 97.63 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 96.07 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 95.94 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 95.93 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 95.89 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 95.8 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 95.55 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.58 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.71 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.51 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 93.11 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.08 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 92.91 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.88 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 92.22 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 92.06 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 91.36 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 91.32 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 90.84 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 90.1 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 89.99 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 89.48 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 87.93 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 87.93 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 86.77 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 86.38 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 85.77 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 84.75 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 84.36 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 83.28 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 83.16 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.38 E-value=1.8e-13 Score=98.46 Aligned_cols=51 Identities=27% Similarity=0.384 Sum_probs=38.3
Q ss_pred CCCCCCCCCCCCCCCCCEEEccccccCCCCCcHHHHHHHHHHHHHHHHHHH
Q 033157 44 GPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAR 94 (126)
Q Consensus 44 ~pG~~~~rp~~~tp~~~L~lAGd~t~~~~patmeGAv~SG~~AA~~Il~~~ 94 (126)
+++....+|..++|++|||||||+|+..||++||||+.||++||++|++.+
T Consensus 397 p~~~~~~~~~~~~~~~~l~fAGe~t~~~~~g~~~GA~~SG~~aA~~Il~~~ 447 (449)
T d2dw4a2 397 PITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQF 447 (449)
T ss_dssp CBCC---------CCCCEEECSGGGCTTSCSSHHHHHHHHHHHHHHHHHHH
T ss_pred CccccccchhhcCCCCCEEEEcCCcCCCCceehHHHHHHHHHHHHHHHHHh
Confidence 334455678889999999999999999999999999999999999999875
|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|