Citrus Sinensis ID: 033159

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------

MLLIHCHFALVLEKNKWFYMQVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLILGLAFAVRHYTKKE

cHHHHHHHHHccccccEEEEEEEccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*LLIHCHFALVLEKNKWFYMQVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDI************************PEFIIKILQILVPLLILGLAFAVRHYTKK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLLIHCHFALVLEKNKWFYMQVYDVSSFMDDHPGGDEVLISATGKDATNDFEDVGHSDSAREMMDKYYIGDIDPSTVPRKRAYIPPQQPAYNQDKTPEFIIKILQILVPLLILGLAFAVRHYTKKE

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome b5 isoform A	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.	confident	Q42342
Cytochrome b5	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.	probable	P40934
Cytochrome b5	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.	probable	P49100

No EC number assigned to the protein, probably not an enzyme!

Template: 1HKO, chain A
Confidence level:very confident
Coverage over the Query: 9-80
View the alignment between query and template
View the model in PyMOL