Query         033184
Match_columns 125
No_of_seqs    51 out of 53
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 10:50:50 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033184.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033184hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07712 SURNod19:  Stress up-r 100.0 1.3E-41 2.8E-46  290.1   6.9   73    1-73    309-381 (381)
  2 PF01299 Lamp:  Lysosome-associ  84.1    0.69 1.5E-05   37.8   2.0   17  105-123   290-306 (306)
  3 cd06577 PASTA_pknB PASTA domai  72.0     6.1 0.00013   22.8   3.0   27   16-46     35-61  (62)
  4 smart00740 PASTA PASTA domain.  71.5     6.5 0.00014   23.1   3.1   26   17-46     39-64  (66)
  5 TIGR02657 amicyanin amicyanin.  71.1       8 0.00017   25.7   3.8   34   22-57      1-34  (83)
  6 PF03793 PASTA:  PASTA domain;   66.1      16 0.00035   22.5   4.2   31   13-47     32-62  (63)
  7 cd06575 PASTA_Pbp2x-like_2 PAS  56.5      15 0.00033   20.8   2.7   25   18-46     29-53  (54)
  8 PF13473 Cupredoxin_1:  Cupredo  51.0      22 0.00048   24.2   3.2   39   20-58     23-61  (104)
  9 PF00127 Copper-bind:  Copper b  49.2      21 0.00046   24.3   2.9   30   28-59     13-42  (99)
 10 cd06573 PASTA PASTA domain. Th  48.2      24 0.00052   19.9   2.6   24   18-45     28-52  (53)
 11 PF03967 PRCH:  Photosynthetic   45.7      30 0.00064   27.0   3.5   30   91-120    10-40  (136)
 12 cd06576 PASTA_Pbp2x-like_1 PAS  40.4      28 0.00061   20.0   2.1   18   28-46     37-54  (55)
 13 TIGR01167 LPXTG_anchor LPXTG-m  40.3      40 0.00087   18.8   2.7   18   96-113    13-31  (34)
 14 PF08114 PMP1_2:  ATPase proteo  38.1      19 0.00041   23.4   1.1   26   97-122    15-42  (43)
 15 PRK02710 plastocyanin; Provisi  35.8      53  0.0011   23.4   3.3   40   16-57     27-70  (119)
 16 PF01102 Glycophorin_A:  Glycop  35.0      38 0.00082   25.5   2.5   20   97-116    73-95  (122)
 17 TIGR02656 cyanin_plasto plasto  33.9      64  0.0014   22.0   3.4   28   28-57     13-40  (99)
 18 TIGR02375 pseudoazurin pseudoa  32.8      41 0.00089   24.6   2.4   20   28-47     11-30  (116)
 19 PRK06518 hypothetical protein;  32.7      31 0.00068   27.0   1.8   16   32-47     26-41  (177)
 20 PF15330 SIT:  SHP2-interacting  31.5      58  0.0012   23.9   2.9   11  107-117    19-29  (107)
 21 COG3086 RseC Positive regulato  30.2      53  0.0011   26.1   2.7   30   95-124   108-138 (150)
 22 cd00226 PRCH Photosynthetic re  30.1      57  0.0012   27.5   3.1   32   90-121     9-41  (246)
 23 TIGR03096 nitroso_cyanin nitro  29.9      85  0.0018   24.1   3.7   34   27-60     56-89  (135)
 24 PF12191 stn_TNFRSF12A:  Tumour  28.9      19  0.0004   28.0   0.0   17  105-121    95-111 (129)
 25 PRK15444 pduC propanediol dehy  27.9      39 0.00084   31.5   1.8   33   17-51     25-58  (554)
 26 TIGR01150 puhA photosynthetic   27.1      72  0.0016   27.2   3.2   32   90-121     9-41  (252)
 27 PF10017 Methyltransf_33:  Hist  26.5      68  0.0015   23.2   2.6   35   18-52     60-98  (127)
 28 PF08374 Protocadherin:  Protoc  24.7      55  0.0012   27.4   2.0   16  107-122    59-74  (221)
 29 cd03687 Dehydratase_LU Dehydra  24.4      48   0.001   30.9   1.8   33   17-51     18-51  (545)
 30 smart00326 SH3 Src homology 3   24.4 1.4E+02   0.003   16.6   3.5   32   19-50      3-35  (58)
 31 PF04246 RseC_MucC:  Positive r  24.1      76  0.0017   22.8   2.5   18   34-51     50-67  (135)
 32 PF03712 Cu2_monoox_C:  Copper   23.7      57  0.0012   24.5   1.8   24   29-52     82-105 (156)
 33 KOG4818 Lysosomal-associated m  23.6      65  0.0014   28.7   2.3   11  113-123   352-362 (362)
 34 COG4807 Uncharacterized protei  23.3      22 0.00047   28.3  -0.5   30   94-123    23-52  (155)
 35 PF14392 zf-CCHC_4:  Zinc knuck  23.2 1.2E+02  0.0027   18.6   3.0   27   34-60     13-42  (49)
 36 TIGR03102 halo_cynanin halocya  22.9 1.1E+02  0.0024   22.4   3.1   29   28-57     38-66  (115)
 37 PF07653 SH3_2:  Variant SH3 do  22.7      90  0.0019   19.0   2.3   25   21-45      2-27  (55)
 38 COG1558 FlgC Flagellar basal b  22.3      49  0.0011   25.9   1.2   16    6-21     79-94  (137)
 39 cd05762 Ig8_MLCK Eighth immuno  21.9 1.4E+02   0.003   20.1   3.3   25   30-54      6-30  (98)
 40 PF08253 Leader_Erm:  Erm Leade  21.0      22 0.00048   19.6  -0.6   13   58-70      1-13  (19)
 41 PTZ00382 Variant-specific surf  20.4      58  0.0013   23.2   1.2    8   96-103    76-83  (96)
 42 PF14874 PapD-like:  Flagellar-  20.2 1.5E+02  0.0032   19.6   3.1   24   25-50     50-73  (102)

No 1  
>PF07712 SURNod19:  Stress up-regulated Nod 19;  InterPro: IPR011692 This family of plant proteins have been implicated in nodule development [] in the legume Medicago truncatula (Barrel medic). MtN-19 was shown by Northern blot to be induced during nodulation []. The molecular function of these proteins is unknown. 
Probab=100.00  E-value=1.3e-41  Score=290.11  Aligned_cols=73  Identities=70%  Similarity=1.276  Sum_probs=71.5

Q ss_pred             CcccCCCccCCCCCCCCcccEEEeeeeecCCCeeeeccCceEEEEEeecCCCCceehhhhhhhhhhccCCCCC
Q 033184            1 MCSSIPAYGNGKEAGNEAGYIVGMSTCYPKPGFLRITDKETLIVESNYSSSHDHTGVMGLFYILVADRVPESS   73 (125)
Q Consensus         1 iC~S~P~YG~G~eaGNE~GYvVGMStCyP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGvMGlfyi~vAe~~p~~~   73 (125)
                      ||+|+|+||+|+|||||+|||||||||||+|||+||+|||+|||||+|||+++||||||||||+||||+|++.
T Consensus       309 lCsS~P~YG~G~EaGNE~GYvVGMStCyP~pgsvkI~dGE~L~l~s~Ys~~~~HTGVMGlfyilvAe~~p~~~  381 (381)
T PF07712_consen  309 LCSSIPQYGTGKEAGNEKGYVVGMSTCYPKPGSVKISDGETLTLESNYSNTQEHTGVMGLFYILVAEQLPHPE  381 (381)
T ss_pred             eeccccccCCCCcCCcccceEEEeeeeecCCCCeEecCCCEEEEEEEecCCCCccchHHHHHHHHhhhcCCCC
Confidence            7999999999999999999999999999999999999999999999999999999999999999999999863


No 2  
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=84.12  E-value=0.69  Score=37.75  Aligned_cols=17  Identities=41%  Similarity=0.397  Sum_probs=10.1

Q ss_pred             HHHhhhhhhcccccCCccc
Q 033184          105 AAAVGYWRRNKYEDGYQPI  123 (125)
Q Consensus       105 vA~v~~~~k~~~~~gY~~l  123 (125)
                      ||.+..|||  .+.|||++
T Consensus       290 iaYli~Rrr--~~~gYq~~  306 (306)
T PF01299_consen  290 IAYLIGRRR--SRAGYQSI  306 (306)
T ss_pred             HhheeEecc--cccccccC
Confidence            555555444  33499986


No 3  
>cd06577 PASTA_pknB PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis. PknB is a receptor-like transmembrane protein with an extracellular signal sensor domain (containing multiple PASTA domains) and an intracellular, eukaryotic serine/threonine kinase-like domain. The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBPs) and bacterial serine/threonine kinases.  The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain.
Probab=72.05  E-value=6.1  Score=22.77  Aligned_cols=27  Identities=15%  Similarity=0.336  Sum_probs=20.1

Q ss_pred             CCcccEEEeeeeecCCCeeeeccCceEEEEE
Q 033184           16 NEAGYIVGMSTCYPKPGFLRITDKETLIVES   46 (125)
Q Consensus        16 NE~GYvVGMStCyP~Pgs~kI~dGE~L~l~s   46 (125)
                      .++|.|+..   .|.||+ ++..|+.++|..
T Consensus        35 ~~~g~V~~q---~p~~G~-~v~~~~~i~l~v   61 (62)
T cd06577          35 VPKGTVISQ---SPAAGT-KVKKGSTVTLTV   61 (62)
T ss_pred             CCCCEEEEe---cCCCCC-ccCCCCEEEEEE
Confidence            357877765   599997 677788888754


No 4  
>smart00740 PASTA PASTA domain.
Probab=71.46  E-value=6.5  Score=23.12  Aligned_cols=26  Identities=15%  Similarity=0.332  Sum_probs=20.3

Q ss_pred             CcccEEEeeeeecCCCeeeeccCceEEEEE
Q 033184           17 EAGYIVGMSTCYPKPGFLRITDKETLIVES   46 (125)
Q Consensus        17 E~GYvVGMStCyP~Pgs~kI~dGE~L~l~s   46 (125)
                      .+|.|+..   .|.||+ ++..|+.++|..
T Consensus        39 ~~g~V~~q---~p~~G~-~v~~~~~i~l~v   64 (66)
T smart00740       39 EEGTVIKQ---SPAAGT-TVKPGSKVTLTV   64 (66)
T ss_pred             CCCEEEEe---CCCCCC-CcCCCCEEEEEE
Confidence            47788775   599998 688899888754


No 5  
>TIGR02657 amicyanin amicyanin. Members of this family are amicyanin, a type I blue copper protein that accepts electrons from the tryptophan tryptophylquinone (TTQ) cofactor of the methylamine dehydrogenase light chain and then transfers them to the heme group of cytochrome c-551i. Amicyanin, methylamine dehydrogenase, and cytochrome c-551i are periplasmic and form a complex. This system has been studied primarily in Paracoccus denitrificans and Methylobacterium extorquens. Related type I blue copper proteins include plastocyanin, pseudoazurin, halocyanin, etc.
Probab=71.14  E-value=8  Score=25.72  Aligned_cols=34  Identities=12%  Similarity=0.037  Sum_probs=25.6

Q ss_pred             EEeeeeecCCCeeeeccCceEEEEEeecCCCCceeh
Q 033184           22 VGMSTCYPKPGFLRITDKETLIVESNYSSSHDHTGV   57 (125)
Q Consensus        22 VGMStCyP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGv   57 (125)
                      |-+..|-..|..++|..|++++++-+  ....|+=.
T Consensus         1 v~i~~~~F~P~~i~v~~GdtVt~~N~--d~~~Hnv~   34 (83)
T TIGR02657         1 VDIAKMKYETPELHVKVGDTVTWINR--EAMPHNVH   34 (83)
T ss_pred             CEEEeeEEcCCEEEECCCCEEEEEEC--CCCCccEE
Confidence            35778999999999999999998532  23467643


No 6  
>PF03793 PASTA:  PASTA domain;  InterPro: IPR005543 The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBP) and bacterial serine/threonine kinases. It binds the beta-lactam stem, which implicates it in sensing D-alanyl-D-alanine - the PBP transpeptidase substrate. In PknB of Mycobacterium tuberculosis (P71584 from SWISSPROT), all of the extracellular portion is predicted to be made up of four PASTA domains, which strongly suggests that it is a signal-binding sensor domain. The domain has also been found in proteins involved in cell wall biosynthesis, where it is implicated in localizing the biosynthesis complex to unlinked peptidoglycan. PASTA is a small globular fold consisting of 3 beta-sheets and an alpha-helix, with a loop region of variable length between the first and second beta-strands. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain [].; GO: 0008658 penicillin binding; PDB: 2ZC3_C 1QME_A 1RP5_B 2Z2M_C 2Z2L_F 2ZC4_C 1QMF_A 3M9G_A 3PY9_A 1K25_B ....
Probab=66.09  E-value=16  Score=22.48  Aligned_cols=31  Identities=13%  Similarity=0.369  Sum_probs=22.9

Q ss_pred             CCCCCcccEEEeeeeecCCCeeeeccCceEEEEEe
Q 033184           13 EAGNEAGYIVGMSTCYPKPGFLRITDKETLIVESN   47 (125)
Q Consensus        13 eaGNE~GYvVGMStCyP~Pgs~kI~dGE~L~l~s~   47 (125)
                      ....++|.|+..   .|.||+ ++..|..++|..+
T Consensus        32 ~~~~~~g~V~~Q---~P~~G~-~v~~~~~I~l~vs   62 (63)
T PF03793_consen   32 SDSVPKGTVISQ---SPAPGT-KVKKGSKITLTVS   62 (63)
T ss_dssp             ESSSSTTSEEEE---SSCTTS-EEETTSEEEEEEE
T ss_pred             cCCCCCCEEEEE---ECCCCC-CcCCCCEEEEEEe
Confidence            344567777654   699998 7788999988753


No 7  
>cd06575 PASTA_Pbp2x-like_2 PASTA domain of PBP2x-like proteins, second repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are attached to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=56.55  E-value=15  Score=20.79  Aligned_cols=25  Identities=28%  Similarity=0.510  Sum_probs=18.9

Q ss_pred             cccEEEeeeeecCCCeeeeccCceEEEEE
Q 033184           18 AGYIVGMSTCYPKPGFLRITDKETLIVES   46 (125)
Q Consensus        18 ~GYvVGMStCyP~Pgs~kI~dGE~L~l~s   46 (125)
                      +|.|+.   ..|.||+ ++..|++++|..
T Consensus        29 ~g~v~~---q~p~~g~-~v~~~~~v~l~v   53 (54)
T cd06575          29 SGYVVS---QSIAPGT-KVKKGTTITVTL   53 (54)
T ss_pred             ceEEEE---ecCCCCC-CCCCCCEEEEEE
Confidence            566644   6899997 588899988864


No 8  
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=50.98  E-value=22  Score=24.19  Aligned_cols=39  Identities=10%  Similarity=0.140  Sum_probs=22.4

Q ss_pred             cEEEeeeeecCCCeeeeccCceEEEEEeecCCCCceehh
Q 033184           20 YIVGMSTCYPKPGFLRITDKETLIVESNYSSSHDHTGVM   58 (125)
Q Consensus        20 YvVGMStCyP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGvM   58 (125)
                      .-|-++.=...|..++++.|+.++|+..-.++..|.=+.
T Consensus        23 v~I~~~~~~f~P~~i~v~~G~~v~l~~~N~~~~~h~~~i   61 (104)
T PF13473_consen   23 VTITVTDFGFSPSTITVKAGQPVTLTFTNNDSRPHEFVI   61 (104)
T ss_dssp             -------EEEES-EEEEETTCEEEEEEEE-SSS-EEEEE
T ss_pred             ccccccCCeEecCEEEEcCCCeEEEEEEECCCCcEEEEE
Confidence            455566666778899999999999988666555665443


No 9  
>PF00127 Copper-bind:  Copper binding proteins, plastocyanin/azurin family;  InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. This pollen protein is evolutionary related to the above proteins, but seems to have lost the ability to bind copper. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1UAT_A 1CUO_A 1PLC_A 4PCY_A 3PCY_A 1PND_A 1PNC_A 1JXG_A 6PCY_A 1TKW_A ....
Probab=49.21  E-value=21  Score=24.26  Aligned_cols=30  Identities=20%  Similarity=0.201  Sum_probs=22.8

Q ss_pred             ecCCCeeeeccCceEEEEEeecCCCCceehhh
Q 033184           28 YPKPGFLRITDKETLIVESNYSSSHDHTGVMG   59 (125)
Q Consensus        28 yP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGvMG   59 (125)
                      ...|-.++|+.|++++++-+  +..+|+=+..
T Consensus        13 ~F~P~~i~V~~G~tV~~~n~--~~~~Hnv~~~   42 (99)
T PF00127_consen   13 AFDPSEITVKAGDTVTFVNN--DSMPHNVVFV   42 (99)
T ss_dssp             SEESSEEEEETTEEEEEEEE--SSSSBEEEEE
T ss_pred             EEeCCEEEECCCCEEEEEEC--CCCCceEEEe
Confidence            46788999999999998877  4456765543


No 10 
>cd06573 PASTA PASTA domain. This domain is found at the C-termini of several Penicillin-binding proteins (PBPs) and bacterial serine/threonine kinases. It is a small globular fold consisting of 3 beta-sheets and an alpha-helix. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain.
Probab=48.22  E-value=24  Score=19.94  Aligned_cols=24  Identities=21%  Similarity=0.451  Sum_probs=17.5

Q ss_pred             ccc-EEEeeeeecCCCeeeeccCceEEEE
Q 033184           18 AGY-IVGMSTCYPKPGFLRITDKETLIVE   45 (125)
Q Consensus        18 ~GY-vVGMStCyP~Pgs~kI~dGE~L~l~   45 (125)
                      +|+ |+.   -.|.||+ ++..|++++|.
T Consensus        28 ~g~~v~~---q~p~~g~-~v~~~~~i~l~   52 (53)
T cd06573          28 SGNKVVK---QSPEAGT-KVAEGSTIRIY   52 (53)
T ss_pred             CCCEEEE---eCCCCCC-CcCCCCEEEEE
Confidence            467 544   4689997 68888988874


No 11 
>PF03967 PRCH:  Photosynthetic reaction centre, H-chain N-terminal region;  InterPro: IPR015810  The photosynthetic apparatus in non-oxygenic bacteria consists of light-harvesting (LH) protein-pigment complexes LH1 and LH2, which use carotenoid and bacteriochlorophyll as primary donors []. LH1 acts as the energy collection hub, temporarily storing it before its transfer to the photosynthetic reaction centre (RC) []. Electrons are transferred from the primary donor via an intermediate acceptor (bacteriopheophytin) to the primary acceptor (quinine Qa), and finally to the secondary acceptor (quinone Qb), resulting in the formation of ubiquinol QbH2. RC uses the excitation energy to shuffle electrons across the membrane, transferring them via ubiquinol to the cytochrome bc1 complex in order to establish a proton gradient across the membrane, which is used by ATP synthetase to form ATP [, , ].  The core complex is anchored in the cell membrane, consisting of one unit of RC surrounded by LH1; in some species there may be additional subunits []. RC consists of three subunits: L (light), M (medium), and H (heavy). Subunits L and M provide the scaffolding for the chromophore, while subunit H contains a cytoplasmic domain []. In Rhodopseudomonas viridis, there is also a non-membranous tetrahaem cytochrome (4Hcyt) subunit on the periplasmic surface.  This entry represents the N-terminal domain of the photosynthetic reaction centre H subunit, which includes the transmembrane domain and part of the cytoplasmic domain [].; GO: 0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, 0019684 photosynthesis, light reaction, 0030077 plasma membrane light-harvesting complex; PDB: 1RZZ_H 1PST_H 2J8D_H 3DUQ_H 1FNP_H 1KBY_H 1E14_H 2HG3_H 1UMX_H 1YST_H ....
Probab=45.74  E-value=30  Score=27.04  Aligned_cols=30  Identities=33%  Similarity=0.435  Sum_probs=23.9

Q ss_pred             ehhhHHHHHHHHHHHH-HhhhhhhcccccCC
Q 033184           91 FVWGAFVLAGVAITAA-AVGYWRRNKYEDGY  120 (125)
Q Consensus        91 ~~~~~v~v~g~a~~vA-~v~~~~k~~~~~gY  120 (125)
                      .-++-++|+..-+-.| .|.|.+|-++||||
T Consensus        10 ~DvAql~lyaFwiFFagLi~YLrrEdkREGY   40 (136)
T PF03967_consen   10 FDVAQLVLYAFWIFFAGLIYYLRREDKREGY   40 (136)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHTTSSST
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHhccccccCC
Confidence            3456777777777766 88899999999999


No 12 
>cd06576 PASTA_Pbp2x-like_1 PASTA domain of PBP2x-like proteins, first repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are connected to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=40.42  E-value=28  Score=19.97  Aligned_cols=18  Identities=22%  Similarity=0.571  Sum_probs=15.0

Q ss_pred             ecCCCeeeeccCceEEEEE
Q 033184           28 YPKPGFLRITDKETLIVES   46 (125)
Q Consensus        28 yP~Pgs~kI~dGE~L~l~s   46 (125)
                      .|.||+ ++..|++++|.+
T Consensus        37 ~p~~g~-~v~~~~~i~l~~   54 (55)
T cd06576          37 SPKPGE-KVLEGSKVLLYT   54 (55)
T ss_pred             cCCCCC-EeCCCCEEEEec
Confidence            799997 788999988854


No 13 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=40.27  E-value=40  Score=18.78  Aligned_cols=18  Identities=17%  Similarity=0.340  Sum_probs=7.2

Q ss_pred             HHHHHHHHH-HHHhhhhhh
Q 033184           96 FVLAGVAIT-AAAVGYWRR  113 (125)
Q Consensus        96 v~v~g~a~~-vA~v~~~~k  113 (125)
                      .+++|+++. ++.+.+++|
T Consensus        13 ~~~~G~~l~~~~~~~~~~r   31 (34)
T TIGR01167        13 LLLLGLLLLGLGGLLLRKR   31 (34)
T ss_pred             HHHHHHHHHHHHHHHheec
Confidence            344444333 344444333


No 14 
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=38.10  E-value=19  Score=23.42  Aligned_cols=26  Identities=19%  Similarity=0.174  Sum_probs=14.9

Q ss_pred             HHHHHHHH--HHHhhhhhhcccccCCcc
Q 033184           97 VLAGVAIT--AAAVGYWRRNKYEDGYQP  122 (125)
Q Consensus        97 ~v~g~a~~--vA~v~~~~k~~~~~gY~~  122 (125)
                      .++|++.+  +|++.||+-+.+.++-|+
T Consensus        15 ~lVglv~i~iva~~iYRKw~aRkr~l~r   42 (43)
T PF08114_consen   15 CLVGLVGIGIVALFIYRKWQARKRALQR   42 (43)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            34444433  668888655666655554


No 15 
>PRK02710 plastocyanin; Provisional
Probab=35.77  E-value=53  Score=23.38  Aligned_cols=40  Identities=23%  Similarity=0.189  Sum_probs=27.2

Q ss_pred             CCcccEEEeee----eecCCCeeeeccCceEEEEEeecCCCCceeh
Q 033184           16 NEAGYIVGMST----CYPKPGFLRITDKETLIVESNYSSSHDHTGV   57 (125)
Q Consensus        16 NE~GYvVGMSt----CyP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGv   57 (125)
                      ..+-+-|-|.+    =...|..++|..|++++++-+  +..+|+-+
T Consensus        27 ~a~~~~V~~~~~~~~~~F~P~~i~v~~Gd~V~~~N~--~~~~H~v~   70 (119)
T PRK02710         27 SAETVEVKMGSDAGMLAFEPSTLTIKAGDTVKWVNN--KLAPHNAV   70 (119)
T ss_pred             ccceEEEEEccCCCeeEEeCCEEEEcCCCEEEEEEC--CCCCceEE
Confidence            34445566642    367888999999999998632  34578754


No 16 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=34.99  E-value=38  Score=25.54  Aligned_cols=20  Identities=30%  Similarity=0.127  Sum_probs=7.9

Q ss_pred             HHHHHHHH---HHHhhhhhhccc
Q 033184           97 VLAGVAIT---AAAVGYWRRNKY  116 (125)
Q Consensus        97 ~v~g~a~~---vA~v~~~~k~~~  116 (125)
                      |++|++..   |+.+..|+||+.
T Consensus        73 v~aGvIg~Illi~y~irR~~Kk~   95 (122)
T PF01102_consen   73 VMAGVIGIILLISYCIRRLRKKS   95 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHS---
T ss_pred             HHHHHHHHHHHHHHHHHHHhccC
Confidence            44454443   444444444443


No 17 
>TIGR02656 cyanin_plasto plastocyanin. Members of this family are plastocyanin, a blue copper protein related to pseudoazurin, halocyanin, amicyanin, etc. This protein, located in the thylakoid luman, performs electron transport to photosystem I in Cyanobacteria and chloroplasts.
Probab=33.85  E-value=64  Score=22.02  Aligned_cols=28  Identities=21%  Similarity=0.197  Sum_probs=20.4

Q ss_pred             ecCCCeeeeccCceEEEEEeecCCCCceeh
Q 033184           28 YPKPGFLRITDKETLIVESNYSSSHDHTGV   57 (125)
Q Consensus        28 yP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGv   57 (125)
                      ...|..+.|+.|+++++.-+  ...+|+=+
T Consensus        13 ~F~P~~i~v~~G~~V~~~N~--~~~~H~~~   40 (99)
T TIGR02656        13 VFEPAKISIAAGDTVEWVNN--KGGPHNVV   40 (99)
T ss_pred             eEeCCEEEECCCCEEEEEEC--CCCCceEE
Confidence            47788999999999998721  23567544


No 18 
>TIGR02375 pseudoazurin pseudoazurin. Pseudoazurin, also called cupredoxin, is a small, blue periplasmic protein with a single bound copper atom. Pseudoazurin is related plastocyanins. Several examples of pseudoazurin are encoded by a neighboring gene for, or have been shown to transfer electrons to, copper-containing nitrite reductases (TIGR02376) of the same species.
Probab=32.75  E-value=41  Score=24.64  Aligned_cols=20  Identities=15%  Similarity=0.343  Sum_probs=18.0

Q ss_pred             ecCCCeeeeccCceEEEEEe
Q 033184           28 YPKPGFLRITDKETLIVESN   47 (125)
Q Consensus        28 yP~Pgs~kI~dGE~L~l~s~   47 (125)
                      .+.|..++|+.||+++++-+
T Consensus        11 ~F~P~~v~V~~GdTV~f~n~   30 (116)
T TIGR02375        11 VFEPAYIRAAPGDTVTFVPT   30 (116)
T ss_pred             EEeCCEEEECCCCEEEEEEC
Confidence            57899999999999999875


No 19 
>PRK06518 hypothetical protein; Provisional
Probab=32.65  E-value=31  Score=27.05  Aligned_cols=16  Identities=19%  Similarity=0.243  Sum_probs=13.7

Q ss_pred             CeeeeccCceEEEEEe
Q 033184           32 GFLRITDKETLIVESN   47 (125)
Q Consensus        32 gs~kI~dGE~L~l~s~   47 (125)
                      |.++|.||+||+|..+
T Consensus        26 G~v~V~DGDTl~l~~~   41 (177)
T PRK06518         26 GRAQVTSGVTFKLIAD   41 (177)
T ss_pred             ceEEEEcCCEEEEeec
Confidence            6789999999999653


No 20 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=31.52  E-value=58  Score=23.86  Aligned_cols=11  Identities=0%  Similarity=0.229  Sum_probs=4.7

Q ss_pred             Hhhhhhhcccc
Q 033184          107 AVGYWRRNKYE  117 (125)
Q Consensus       107 ~v~~~~k~~~~  117 (125)
                      .+.||.++++.
T Consensus        19 l~~wr~~~rq~   29 (107)
T PF15330_consen   19 LLAWRMKQRQK   29 (107)
T ss_pred             HHHHHHHhhhc
Confidence            44444444333


No 21 
>COG3086 RseC Positive regulator of sigma E activity [Signal transduction mechanisms]
Probab=30.21  E-value=53  Score=26.10  Aligned_cols=30  Identities=23%  Similarity=0.322  Sum_probs=21.9

Q ss_pred             HHHHHHHHHH-HHHhhhhhhcccccCCcccC
Q 033184           95 AFVLAGVAIT-AAAVGYWRRNKYEDGYQPIM  124 (125)
Q Consensus        95 ~v~v~g~a~~-vA~v~~~~k~~~~~gY~~ll  124 (125)
                      +.+++|.+.. +.+..|.||.+.+..|||.+
T Consensus       108 ~~~~lg~~l~fl~~r~ysRkl~~~~~~QpVi  138 (150)
T COG3086         108 FGAFLGLALGFLLARRYSRKLAKRTEWQPVI  138 (150)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCCCeE
Confidence            3355555555 55788889999999999975


No 22 
>cd00226 PRCH Photosynthetic reaction center (RC) complex, subunit H;  RC is an integral membrane protein-pigment complex which catalyzes light-induced reduction of ubiquinone to ubiquinol, generating a transmembrane electrochemical gradient of protons used to produce ATP by ATP synthase. Subunit H is positioned mainly in the cytoplasm with one transmembrane alpha helix. Provides proton transfer pathway (water channels) connecting the terminal quinone electron acceptor of RC, to the aqueous phase. Found in photosynthetic bacteria: alpha, beta, and gamma proteobacteria.
Probab=30.12  E-value=57  Score=27.51  Aligned_cols=32  Identities=28%  Similarity=0.414  Sum_probs=24.8

Q ss_pred             eehhhHHHHHHHHHHHH-HhhhhhhcccccCCc
Q 033184           90 AFVWGAFVLAGVAITAA-AVGYWRRNKYEDGYQ  121 (125)
Q Consensus        90 ~~~~~~v~v~g~a~~vA-~v~~~~k~~~~~gY~  121 (125)
                      ..-++-++|+..-+..| .|.|.+|-++||||-
T Consensus         9 ~~D~A~~~l~~Fw~ffa~Li~YL~~E~~REGYP   41 (246)
T cd00226           9 YFDLAQLVIYAFWIFFAGLIYYLRRENMREGYP   41 (246)
T ss_pred             eccHHHHHHHHHHHHHHHHHHHHhccccccCCC
Confidence            34557777887777766 888888889999994


No 23 
>TIGR03096 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as described from the obligate chemolithoautotroph Nitrosomonas europaea, is a red copper protein of unknown function with sequence similarity to a number of blue copper redox proteins.
Probab=29.89  E-value=85  Score=24.08  Aligned_cols=34  Identities=12%  Similarity=0.065  Sum_probs=26.0

Q ss_pred             eecCCCeeeeccCceEEEEEeecCCCCceehhhh
Q 033184           27 CYPKPGFLRITDKETLIVESNYSSSHDHTGVMGL   60 (125)
Q Consensus        27 CyP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGvMGl   60 (125)
                      -+.+|..|+++.|+++++...=.+...|+-.+.-
T Consensus        56 ~~~~P~~I~VkaGD~Vtl~vtN~d~~~H~f~i~~   89 (135)
T TIGR03096        56 VLNEPEALVVKKGTPVKVTVENKSPISEGFSIDA   89 (135)
T ss_pred             eEEcCCEEEECCCCEEEEEEEeCCCCccceEECC
Confidence            4678889999999999998764444578766644


No 24 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=28.89  E-value=19  Score=28.00  Aligned_cols=17  Identities=18%  Similarity=0.487  Sum_probs=0.0

Q ss_pred             HHHhhhhhhcccccCCc
Q 033184          105 AAAVGYWRRNKYEDGYQ  121 (125)
Q Consensus       105 vA~v~~~~k~~~~~gY~  121 (125)
                      +|-+.+|||+++++-+.
T Consensus        95 lsg~lv~rrcrrr~~~t  111 (129)
T PF12191_consen   95 LSGFLVWRRCRRREKFT  111 (129)
T ss_dssp             -----------------
T ss_pred             HHHHHHHhhhhccccCC
Confidence            45666778877776553


No 25 
>PRK15444 pduC propanediol dehydratase large subunit; Provisional
Probab=27.92  E-value=39  Score=31.50  Aligned_cols=33  Identities=21%  Similarity=0.438  Sum_probs=21.6

Q ss_pred             CcccEEEee-eeecCCCeeeeccCceEEEEEeecCC
Q 033184           17 EAGYIVGMS-TCYPKPGFLRITDKETLIVESNYSSS   51 (125)
Q Consensus        17 E~GYvVGMS-tCyP~Pgs~kI~dGE~L~l~s~Ys~~   51 (125)
                      |.|. |.|. ---|+| ||||.||.++.+-..-..+
T Consensus        25 e~Gl-iAm~sp~DPkP-sikienG~vvElDGk~r~d   58 (554)
T PRK15444         25 EEGL-IAMESPNDPKP-SIKIENGKVVELDGKPRED   58 (554)
T ss_pred             ccce-eeccCCCCCCC-ceEeeCCeEEeccCcchHh
Confidence            3443 4554 455777 6999999998876544333


No 26 
>TIGR01150 puhA photosynthetic reaction center, subunit H, bacterial. This model describes the photosynthetic reaction center H subunit in non-oxygenic photosynthetic bacteria. The reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in the form of NADH. Ultimately, the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is an organic acid rather than water. Much of our current functional understanding of photosynthesis comes from the structural determination 
Probab=27.10  E-value=72  Score=27.23  Aligned_cols=32  Identities=28%  Similarity=0.420  Sum_probs=24.7

Q ss_pred             eehhhHHHHHHHHHHHH-HhhhhhhcccccCCc
Q 033184           90 AFVWGAFVLAGVAITAA-AVGYWRRNKYEDGYQ  121 (125)
Q Consensus        90 ~~~~~~v~v~g~a~~vA-~v~~~~k~~~~~gY~  121 (125)
                      ..-++-++|+..-+..| .|.|.+|-++||||-
T Consensus         9 ~~DvAq~~ly~FwiFFA~Li~YLrrEd~REGYP   41 (252)
T TIGR01150         9 HFDLAQLVIYAFWIFLAGLIYYLRREDRREGYP   41 (252)
T ss_pred             eccHHHHHHHHHHHHHHHHHHHHhccccccCCC
Confidence            34457777887777766 888988889999994


No 27 
>PF10017 Methyltransf_33:  Histidine-specific methyltransferase, SAM-dependent;  InterPro: IPR019257  This domain is found in methyltransferases and various hypothetical proteins. 
Probab=26.47  E-value=68  Score=23.18  Aligned_cols=35  Identities=17%  Similarity=0.231  Sum_probs=25.2

Q ss_pred             cccEEE---eeeeecCCC-eeeeccCceEEEEEeecCCC
Q 033184           18 AGYIVG---MSTCYPKPG-FLRITDKETLIVESNYSSSH   52 (125)
Q Consensus        18 ~GYvVG---MStCyP~Pg-s~kI~dGE~L~l~s~Ys~~~   52 (125)
                      +-|++.   .+...+.++ .|.++.||.+.+|.+|+-+.
T Consensus        60 e~~l~~~~~~~v~i~~~~~~i~~~~GE~I~~e~S~Ky~~   98 (127)
T PF10017_consen   60 EMYLVAKRDQTVRIGGLDLTIHFKEGERIHTENSYKYSP   98 (127)
T ss_pred             EEEEEeCCcEEEEEcCCCceeEECCCCEEEEEEeeCcCH
Confidence            345544   334455555 58999999999999999874


No 28 
>PF08374 Protocadherin:  Protocadherin;  InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains. They are expressed in a variety of organisms and are found in high concentrations in the brain where they seem to be localised mainly at cell-cell contact sites. Their expression seems to be developmentally regulated []. 
Probab=24.65  E-value=55  Score=27.38  Aligned_cols=16  Identities=38%  Similarity=0.654  Sum_probs=8.1

Q ss_pred             HhhhhhhcccccCCcc
Q 033184          107 AVGYWRRNKYEDGYQP  122 (125)
Q Consensus       107 ~v~~~~k~~~~~gY~~  122 (125)
                      .+.++|...+..|||.
T Consensus        59 ~vR~CRq~~~k~g~Qa   74 (221)
T PF08374_consen   59 LVRYCRQSPHKKGYQA   74 (221)
T ss_pred             HHHHHhhccccchhhh
Confidence            3333343556667763


No 29 
>cd03687 Dehydratase_LU Dehydratase large subunit. This family contains the large (alpha) subunit of B12-dependent glycerol dehydratases (GDHs) and B12-dependent diol dehydratases (DDHs). GDH is isofunctional with DDH. These enzymes can each catalyze the conversion of 1,2-propanediol, glycerol, and 1,2-ethanediol to the corresponding aldehydes via a coenzyme B12 (adenosylcobalamin)-dependent radical mechanism. Both enzymes exhibit a subunit composition of alpha2beta2gamma2. The enzymes differ in substrate specificity; glycerol is the preferred substrate for GDH and 1,2-propanediol for DDH. GDH shows almost equal affinity for both (R) and (S)-isomers while DDH prefers the (S) isomer. GDH plays a key role in the dihydroxyacetone (DHA) pathway and DDH in the anaerobic degradation of 1,2-diols. The radical mechanism has been well studied for Klebsiella oxytoca DDH and involves binding of 1,2-propanediol to the enzyme to induce hemolytic cleavage of the Co-C5' bond of the coenzyme to form co
Probab=24.43  E-value=48  Score=30.90  Aligned_cols=33  Identities=21%  Similarity=0.446  Sum_probs=21.7

Q ss_pred             CcccEEEeee-eecCCCeeeeccCceEEEEEeecCC
Q 033184           17 EAGYIVGMST-CYPKPGFLRITDKETLIVESNYSSS   51 (125)
Q Consensus        17 E~GYvVGMSt-CyP~Pgs~kI~dGE~L~l~s~Ys~~   51 (125)
                      |.|. |.|.+ --|+| ||||.||.++.+-..-..+
T Consensus        18 e~Gl-iAm~sp~DPkP-SikienG~vvEmDgk~~~d   51 (545)
T cd03687          18 EEGL-IAMESPNDPKP-SIKIVNGRVVELDGKPVAD   51 (545)
T ss_pred             hcce-eeccCCCCCCC-ceEeecCeEEeccCcchHh
Confidence            3443 45554 45666 7999999998886654443


No 30 
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=24.36  E-value=1.4e+02  Score=16.60  Aligned_cols=32  Identities=6%  Similarity=0.038  Sum_probs=23.8

Q ss_pred             ccEEEeeeeecCC-CeeeeccCceEEEEEeecC
Q 033184           19 GYIVGMSTCYPKP-GFLRITDKETLIVESNYSS   50 (125)
Q Consensus        19 GYvVGMStCyP~P-gs~kI~dGE~L~l~s~Ys~   50 (125)
                      .+++.+-.+.++. +.+.+..||.+.+....++
T Consensus         3 ~~~~a~~~~~~~~~~~l~~~~Gd~v~v~~~~~~   35 (58)
T smart00326        3 PQVRALYDYTAQDPDELSFKKGDIITVLEKSDD   35 (58)
T ss_pred             cEEEEeeeeCCCCCCCCCCCCCCEEEEEEcCCC
Confidence            4567777777755 5688999999999876533


No 31 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=24.12  E-value=76  Score=22.78  Aligned_cols=18  Identities=22%  Similarity=0.051  Sum_probs=12.6

Q ss_pred             eeeccCceEEEEEeecCC
Q 033184           34 LRITDKETLIVESNYSSS   51 (125)
Q Consensus        34 ~kI~dGE~L~l~s~Ys~~   51 (125)
                      +..+-||.++++..-++-
T Consensus        50 ~~~~~GD~V~v~i~~~~~   67 (135)
T PF04246_consen   50 IGAKVGDRVEVEIPESSL   67 (135)
T ss_pred             CCCCCCCEEEEEeccchH
Confidence            456678899888865543


No 32 
>PF03712 Cu2_monoox_C:  Copper type II ascorbate-dependent monooxygenase, C-terminal domain; PDB: 1YI9_A 3MLL_A 1SDW_A 3MID_A 1YIP_A 3PHM_A 3MIC_A 3MIB_A 1OPM_A 3MIG_A ....
Probab=23.75  E-value=57  Score=24.45  Aligned_cols=24  Identities=29%  Similarity=0.376  Sum_probs=16.9

Q ss_pred             cCCCeeeeccCceEEEEEeecCCC
Q 033184           29 PKPGFLRITDKETLIVESNYSSSH   52 (125)
Q Consensus        29 P~Pgs~kI~dGE~L~l~s~Ys~~~   52 (125)
                      +-+..++|..|++|..+-.|+|+.
T Consensus        82 ~l~~~v~i~~GD~l~~~C~Ydns~  105 (156)
T PF03712_consen   82 PLKEPVTIPPGDTLRTECTYDNSD  105 (156)
T ss_dssp             EEEEEEEE-TT-EEEEEEEEE-TT
T ss_pred             ECCCceEecCCCEEEEEEEEeCCC
Confidence            333468999999999999999953


No 33 
>KOG4818 consensus Lysosomal-associated membrane protein [General function prediction only]
Probab=23.57  E-value=65  Score=28.74  Aligned_cols=11  Identities=45%  Similarity=0.845  Sum_probs=8.3

Q ss_pred             hcccccCCccc
Q 033184          113 RNKYEDGYQPI  123 (125)
Q Consensus       113 k~~~~~gY~~l  123 (125)
                      |+.++.|||++
T Consensus       352 rr~~~~gYq~i  362 (362)
T KOG4818|consen  352 RRRSHSGYQTI  362 (362)
T ss_pred             heecccccccC
Confidence            34589999985


No 34 
>COG4807 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.26  E-value=22  Score=28.33  Aligned_cols=30  Identities=27%  Similarity=0.420  Sum_probs=21.9

Q ss_pred             hHHHHHHHHHHHHHhhhhhhcccccCCccc
Q 033184           94 GAFVLAGVAITAAAVGYWRRNKYEDGYQPI  123 (125)
Q Consensus        94 ~~v~v~g~a~~vA~v~~~~k~~~~~gY~~l  123 (125)
                      -++++.++-++.+-|.-|.||+.|+|||..
T Consensus        23 ~i~~~~n~~~t~edv~~yLkKedeeGfq~c   52 (155)
T COG4807          23 RILALGNVEATAEDVAVYLKKEDEEGFQRC   52 (155)
T ss_pred             HHHHhcCcccCHHHHHHHHHHhhHhHHhhC
Confidence            455666666667755566899999999964


No 35 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=23.17  E-value=1.2e+02  Score=18.65  Aligned_cols=27  Identities=22%  Similarity=0.425  Sum_probs=19.3

Q ss_pred             eeeccCceEEEEEeecCCC---Cceehhhh
Q 033184           34 LRITDKETLIVESNYSSSH---DHTGVMGL   60 (125)
Q Consensus        34 ~kI~dGE~L~l~s~Ys~~~---~hTGvMGl   60 (125)
                      +++.+||.+++...|-.-.   .|-|.+|+
T Consensus        13 v~~~~g~~~~~~v~YE~lp~~C~~C~~~gH   42 (49)
T PF14392_consen   13 VKFPEGESFWVKVKYERLPRFCFHCGRIGH   42 (49)
T ss_pred             EEeCCCcEEEEEEEECCcChhhcCCCCcCc
Confidence            4556899999999998744   45555554


No 36 
>TIGR03102 halo_cynanin halocyanin domain. Halocyanins are blue (type I) copper redox proteins found in halophilic archaea such as Natronobacterium pharaonis. This model represents a domain duplicated in some halocyanins, while appearing once in others. This domain includes the characteristic copper ligand residues. This family does not include plastocyanins, and does not include certain divergent paralogs of halocyanin.
Probab=22.86  E-value=1.1e+02  Score=22.41  Aligned_cols=29  Identities=21%  Similarity=0.167  Sum_probs=21.8

Q ss_pred             ecCCCeeeeccCceEEEEEeecCCCCceeh
Q 033184           28 YPKPGFLRITDKETLIVESNYSSSHDHTGV   57 (125)
Q Consensus        28 yP~Pgs~kI~dGE~L~l~s~Ys~~~~hTGv   57 (125)
                      -++|..++|+.|++++.+-+- ...+|+=+
T Consensus        38 ~F~P~~ltV~~GdTVtw~~~~-d~~~HnV~   66 (115)
T TIGR03102        38 AFDPPAIRVDPGTTVVWEWTG-EGGGHNVV   66 (115)
T ss_pred             eEeCCEEEECCCCEEEEEECC-CCCCEEEE
Confidence            478889999999999987542 23568754


No 37 
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=22.70  E-value=90  Score=18.98  Aligned_cols=25  Identities=12%  Similarity=0.111  Sum_probs=16.6

Q ss_pred             EEEeeeeec-CCCeeeeccCceEEEE
Q 033184           21 IVGMSTCYP-KPGFLRITDKETLIVE   45 (125)
Q Consensus        21 vVGMStCyP-~Pgs~kI~dGE~L~l~   45 (125)
                      .+.+..+.+ .|+.+.++.||++++.
T Consensus         2 ~~a~~d~~~~~~~~Ls~~~Gd~i~v~   27 (55)
T PF07653_consen    2 YRAIFDYVAEDPDELSFKKGDVIEVL   27 (55)
T ss_dssp             EEESSSBESSSTTB-EB-TTEEEEEE
T ss_pred             EEEeEEECCCCCCceEEecCCEEEEE
Confidence            344445544 5677999999999998


No 38 
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion]
Probab=22.26  E-value=49  Score=25.86  Aligned_cols=16  Identities=25%  Similarity=0.646  Sum_probs=14.6

Q ss_pred             CCccCCCCCCCCcccE
Q 033184            6 PAYGNGKEAGNEAGYI   21 (125)
Q Consensus         6 P~YG~G~eaGNE~GYv   21 (125)
                      .+|-.|++.-||+|||
T Consensus        79 ~~YdP~hP~Ad~~GYV   94 (137)
T COG1558          79 LVYDPGHPDADAKGYV   94 (137)
T ss_pred             eeeCCCCCCccccCce
Confidence            4799999999999997


No 39 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=21.90  E-value=1.4e+02  Score=20.06  Aligned_cols=25  Identities=8%  Similarity=0.130  Sum_probs=19.7

Q ss_pred             CCCeeeeccCceEEEEEeecCCCCc
Q 033184           30 KPGFLRITDKETLIVESNYSSSHDH   54 (125)
Q Consensus        30 ~Pgs~kI~dGE~L~l~s~Ys~~~~h   54 (125)
                      .|-++++..|+.++|...++...+.
T Consensus         6 ~p~~~~v~~G~~v~l~C~~~G~p~p   30 (98)
T cd05762           6 FPEDMKVRAGESVELFCKVTGTQPI   30 (98)
T ss_pred             CCcCEEEECCCEEEEEEEEcccCCC
Confidence            4557889999999999998876543


No 40 
>PF08253 Leader_Erm:  Erm Leader peptide ;  InterPro: IPR013204 These short proteins are leader peptides (15-19 amino acids) of erm genes that code for resistance determinants in Staphylococcus aureus [].
Probab=20.98  E-value=22  Score=19.63  Aligned_cols=13  Identities=46%  Similarity=0.812  Sum_probs=10.2

Q ss_pred             hhhhhhhhhccCC
Q 033184           58 MGLFYILVADRVP   70 (125)
Q Consensus        58 MGlfyi~vAe~~p   70 (125)
                      ||.|.|+|-+...
T Consensus         1 MG~fSiFVI~~vh   13 (19)
T PF08253_consen    1 MGMFSIFVINTVH   13 (19)
T ss_pred             CceEEEEEEEeec
Confidence            8899998887644


No 41 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=20.44  E-value=58  Score=23.16  Aligned_cols=8  Identities=13%  Similarity=0.306  Sum_probs=3.0

Q ss_pred             HHHHHHHH
Q 033184           96 FVLAGVAI  103 (125)
Q Consensus        96 v~v~g~a~  103 (125)
                      ++++++++
T Consensus        76 ~~~v~~lv   83 (96)
T PTZ00382         76 VAVVGGLV   83 (96)
T ss_pred             hhHHHHHH
Confidence            33333333


No 42 
>PF14874 PapD-like:  Flagellar-associated PapD-like
Probab=20.20  E-value=1.5e+02  Score=19.58  Aligned_cols=24  Identities=21%  Similarity=0.351  Sum_probs=20.2

Q ss_pred             eeeecCCCeeeeccCceEEEEEeecC
Q 033184           25 STCYPKPGFLRITDKETLIVESNYSS   50 (125)
Q Consensus        25 StCyP~Pgs~kI~dGE~L~l~s~Ys~   50 (125)
                      -++.|++|  ++..|+..+++..+..
T Consensus        50 ~~v~~~~g--~l~PG~~~~~~V~~~~   73 (102)
T PF14874_consen   50 FSVEPPSG--FLAPGESVELEVTFSP   73 (102)
T ss_pred             EEEECCCC--EECCCCEEEEEEEEEe
Confidence            36678888  7999999999999984


Done!