Query         033199
Match_columns 125
No_of_seqs    48 out of 50
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 11:02:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033199.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033199hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00053 photosystem II subuni 100.0 3.7E-60 7.9E-65  352.3   7.4  102   24-125     1-117 (117)
  2 PF04725 PsbR:  Photosystem II  100.0 6.1E-54 1.3E-58  311.9   5.4   86   40-125     1-99  (99)
  3 PLN00083 photosystem II subuni 100.0 6.8E-38 1.5E-42  228.5   3.6   60   61-123    41-101 (101)
  4 PF03918 CcmH:  Cytochrome C bi  57.7     4.4 9.6E-05   30.7   0.6   40   64-118    82-121 (148)
  5 cd03016 PRX_1cys Peroxiredoxin  55.4      17 0.00037   27.4   3.5   59   26-93    112-175 (203)
  6 COG4678 Muramidase (phage lamb  54.4     6.3 0.00014   32.0   1.0   43   43-88     72-114 (180)
  7 PF05430 Methyltransf_30:  S-ad  46.2     6.6 0.00014   28.7  -0.0   16   73-88     56-71  (124)
  8 CHL00082 psbZ photosystem II p  37.9      33 0.00072   23.5   2.4   23   81-106    29-51  (62)
  9 TIGR03043 PS_II_psbZ photosyst  36.1      32 0.00068   23.3   2.0   23   81-106    26-48  (58)
 10 PRK02576 psbZ photosystem II r  35.9      32 0.00069   23.6   2.0   23   81-106    29-51  (62)
 11 PRK13190 putative peroxiredoxi  35.7      45 0.00098   25.3   3.0   53   32-93    118-175 (202)
 12 PRK10144 formate-dependent nit  35.2      23 0.00051   26.8   1.4   38   63-115    81-118 (126)
 13 PF08576 DUF1764:  Eukaryotic p  34.5      11 0.00024   26.4  -0.3   23   72-96     69-91  (102)
 14 COG4121 Uncharacterized conser  34.0      12 0.00026   31.1  -0.3   16   73-88    174-189 (252)
 15 PF10417 1-cysPrx_C:  C-termina  33.4      41 0.00089   20.4   2.1   22   63-92      2-23  (40)
 16 TIGR03147 cyt_nit_nrfF cytochr  31.4      30 0.00064   26.3   1.5   38   63-115    81-118 (126)
 17 PF13163 DUF3999:  Protein of u  28.9      35 0.00077   29.3   1.7   22   96-117   406-427 (429)
 18 PRK15006 thiosulfate reductase  26.1      46   0.001   26.9   1.8   16   71-86     12-27  (261)
 19 PF13179 DUF4006:  Family of un  24.1      75  0.0016   22.1   2.3   21   94-114    11-31  (66)
 20 PF02388 FemAB:  FemAB family;   22.1      28 0.00061   29.4  -0.2   31   50-80    356-389 (406)
 21 PF01102 Glycophorin_A:  Glycop  20.9      50  0.0011   24.8   1.0   34   84-118    53-86  (122)

No 1  
>PLN00053 photosystem II subunit R; Provisional
Probab=100.00  E-value=3.7e-60  Score=352.28  Aligned_cols=102  Identities=79%  Similarity=1.367  Sum_probs=99.4

Q ss_pred             ccCCCCCCc--ceeEEEEecc-eeeeccccccCCCccccc------------chhhhhhhhcCCCCCccCcccCCCCCCC
Q 033199           24 ARGLPSLAK--TSFKIVAKGG-KIKTDKPYGVNGGMDLRE------------GVYQFVDKYGANVDGYSPIYNENDWSPS   88 (125)
Q Consensus        24 ~~glp~laR--~s~~v~Asg~-Kikt~~P~G~~Ggm~~k~------------Gvyqf~~KyGANVDgYSPIY~p~~ws~~   88 (125)
                      +||||+++|  ++|+|+||++ ||||++|||++|+|++|+            |||||+||||||||||||||+||||||+
T Consensus         1 ~~glp~l~r~~ss~~v~as~~kkikt~~p~G~~G~m~~k~gvDasGRk~kGkGVYqFvdKYGANVDgYSPIY~~~ews~~   80 (117)
T PLN00053          1 VRGLPPLSRTARSFKVTASGGKKIKTDQPYGPSGGMNLKDGVDASGRKGKGKGVYQFVDKYGANVDGYSPIYTPDEWSPS   80 (117)
T ss_pred             CCccCcccccccceEEEecCCceeeecCCcccCCCcccccccCCCCccCCCcceEEehhhcCccccccCCCcChhhcCCC
Confidence            589999999  6899999987 999999999999999997            9999999999999999999999999999


Q ss_pred             CCeeccChhHHHHHHHHHHHHhhhceeeeeecccccC
Q 033199           89 GDVYTGGATGLAIWAVTLAGLLAGGALLVYNTSALAQ  125 (125)
Q Consensus        89 GD~Y~gg~~gL~~wA~tl~glL~~Gallvy~TSaLa~  125 (125)
                      ||+|+|||+||+|||+||+|||++|||||||||||+|
T Consensus        81 Gd~Y~ggttgL~~wa~~l~gll~~gallvynTSaLa~  117 (117)
T PLN00053         81 GDVYVGGTTGLLIWAVTLAGLLAGGALLVYNTSALAQ  117 (117)
T ss_pred             CCeeeCChhhHHHHHHHHHHHHcccceeEEehhhhcC
Confidence            9999999999999999999999999999999999997


No 2  
>PF04725 PsbR:  Photosystem II 10 kDa polypeptide PsbR;  InterPro: IPR006814 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight intrinsic protein PsbR found in PSII, which is also known as the 10 kDa polypeptide. The PsbR gene is found only in the nucleus of green algae and higher plants. PsbR may provide a binding site for the extrinsic oxygen-evolving complex protein PsbP to the thylakoid membrane. PsbR has a transmembrane domain to anchor it to the thylakoid membrane, and a charged N-terminal domain capable of forming ion bridges with extrinsic proteins, allowing PsbR to act as a docking protein. PsbR may be a pH-dependent stabilising protein that functions at both donor and acceptor sides of PSII [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0042651 thylakoid membrane
Probab=100.00  E-value=6.1e-54  Score=311.94  Aligned_cols=86  Identities=84%  Similarity=1.423  Sum_probs=83.8

Q ss_pred             ecc-eeeeccccccCCCccccc------------chhhhhhhhcCCCCCccCcccCCCCCCCCCeeccChhHHHHHHHHH
Q 033199           40 KGG-KIKTDKPYGVNGGMDLRE------------GVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTL  106 (125)
Q Consensus        40 sg~-Kikt~~P~G~~Ggm~~k~------------Gvyqf~~KyGANVDgYSPIY~p~~ws~~GD~Y~gg~~gL~~wA~tl  106 (125)
                      |++ |||||+|||++|+|++|+            |||||+||||||||||||||+||||||+||+|+||++||++||+||
T Consensus         1 Sg~KKIkt~~p~G~~g~m~~k~gvDa~gRkgKg~gVYqf~~KyGANVDgYSPIY~p~~Ws~~GD~Y~gGt~gL~~WA~~l   80 (99)
T PF04725_consen    1 SGGKKIKTDKPYGPSGGMTLKDGVDASGRKGKGKGVYQFVDKYGANVDGYSPIYTPDEWSPSGDVYVGGTTGLLIWAVTL   80 (99)
T ss_pred             CCCccccccCCccCCCCccccCCccCCCCCCCCceeEEehhhcCccccccCCCcChhhcCCCCCeecCChhhHHHHHHHH
Confidence            445 999999999999999998            9999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhceeeeeecccccC
Q 033199          107 AGLLAGGALLVYNTSALAQ  125 (125)
Q Consensus       107 ~glL~~Gallvy~TSaLa~  125 (125)
                      +|||++|||||||||||+|
T Consensus        81 ~glL~~Gallvy~TSaL~q   99 (99)
T PF04725_consen   81 AGLLGGGALLVYNTSALAQ   99 (99)
T ss_pred             HHHHcccceeEEehhhhcC
Confidence            9999999999999999998


No 3  
>PLN00083 photosystem II subunit R; Provisional
Probab=100.00  E-value=6.8e-38  Score=228.50  Aligned_cols=60  Identities=45%  Similarity=0.720  Sum_probs=59.1

Q ss_pred             chhhhhhhhc-CCCCCccCcccCCCCCCCCCeeccChhHHHHHHHHHHHHhhhceeeeeecccc
Q 033199           61 GVYQFVDKYG-ANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVYNTSAL  123 (125)
Q Consensus        61 Gvyqf~~KyG-ANVDgYSPIY~p~~ws~~GD~Y~gg~~gL~~wA~tl~glL~~Gallvy~TSaL  123 (125)
                      |||||+|||| ||||||||||+||||+|+||+|+|   ||++||+||+|||++|||||||||||
T Consensus        41 gVYqf~~KyGkANVDgYSPIY~p~eWs~sGD~Y~G---gL~~WA~tlaglLg~GAllVy~TSaL  101 (101)
T PLN00083         41 YVYKLGLRNGKANVDEYSPIYTPQEFKTDGDKYEG---DLKLAAAAVAGVIGTGALAILLTSAL  101 (101)
T ss_pred             eEEEehhccCcccccccCCccChhhcCCCcchhhc---cHHHHHHHHHHHHccceeEEEecccC
Confidence            9999999999 999999999999999999999998   69999999999999999999999997


No 4  
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=57.74  E-value=4.4  Score=30.68  Aligned_cols=40  Identities=40%  Similarity=0.687  Sum_probs=8.8

Q ss_pred             hhhhhhcCCCCCccCcccCCCCCCCCCeeccChhHHHHHHHHHHHHhhhceeeee
Q 033199           64 QFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVY  118 (125)
Q Consensus        64 qf~~KyGANVDgYSPIY~p~~ws~~GD~Y~gg~~gL~~wA~tl~glL~~Gallvy  118 (125)
                      -|+++||--| =|.|-.+            |  .++++|++-++.++++++++++
T Consensus        82 ~~v~rYG~~V-l~~Pp~~------------~--~~~~lW~~P~~~l~~g~~~~~~  121 (148)
T PF03918_consen   82 YFVERYGEFV-LYEPPFK------------G--FTWLLWLGPFLLLLLGGALLFR  121 (148)
T ss_dssp             HHHHHHTTT--EES--S--------------------------------------
T ss_pred             HHHHhcCcce-eecCCCC------------c--cHHHHHHHHHHHHHHHHHHHHH
Confidence            4799999766 2444322            2  2588999999888888777664


No 5  
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes an
Probab=55.42  E-value=17  Score=27.38  Aligned_cols=59  Identities=25%  Similarity=0.428  Sum_probs=36.3

Q ss_pred             CCCCCCcceeEEEEecceeeeccccccCCCccccc-----chhhhhhhhcCCCCCccCcccCCCCCCCCCeec
Q 033199           26 GLPSLAKTSFKIVAKGGKIKTDKPYGVNGGMDLRE-----GVYQFVDKYGANVDGYSPIYNENDWSPSGDVYT   93 (125)
Q Consensus        26 glp~laR~s~~v~Asg~Kikt~~P~G~~Ggm~~k~-----Gvyqf~~KyGANVDgYSPIY~p~~ws~~GD~Y~   93 (125)
                      +.|...|..| |+...+||.-...+-..-|.++.+     -.+|+.+|+|        .-+|-+|.++.|+-+
T Consensus       112 ~~~~~~r~~f-iID~~G~I~~~~~~~~~~gr~~~ell~~l~~lq~~~~~~--------~~~p~~w~~g~~~~~  175 (203)
T cd03016         112 GSTLTVRAVF-IIDPDKKIRLILYYPATTGRNFDEILRVVDALQLTDKHK--------VATPANWKPGDDVIV  175 (203)
T ss_pred             CCCceeeEEE-EECCCCeEEEEEecCCCCCCCHHHHHHHHHHHhhHhhcC--------cCcCCCCCCCCceec
Confidence            3343456666 666667777666444444544444     4467777663        568999999766543


No 6  
>COG4678 Muramidase (phage lambda lysozyme) [Carbohydrate transport and metabolism]
Probab=54.38  E-value=6.3  Score=32.02  Aligned_cols=43  Identities=30%  Similarity=0.513  Sum_probs=31.8

Q ss_pred             eeeeccccccCCCcccccchhhhhhhhcCCCCCccCcccCCCCCCC
Q 033199           43 KIKTDKPYGVNGGMDLREGVYQFVDKYGANVDGYSPIYNENDWSPS   88 (125)
Q Consensus        43 Kikt~~P~G~~Ggm~~k~Gvyqf~~KyGANVDgYSPIY~p~~ws~~   88 (125)
                      .++..-|-++||--.--.|.|||.+++   -|.|.|-|.|.+|+|.
T Consensus        72 ~~~v~i~~~~ng~cSTAAGrYQ~L~~t---W~~~~~~l~l~dF~P~  114 (180)
T COG4678          72 RKCVTIPTGPNGLCSTAAGRYQLLNRT---WDDYAPQLHLKDFSPE  114 (180)
T ss_pred             hhhEEeecCCCCccccchhhHHHHHhH---HHHhhhhcCcccCChh
Confidence            344455566664333334999999998   7899999999999984


No 7  
>PF05430 Methyltransf_30:  S-adenosyl-L-methionine-dependent methyltransferase;  InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function.; GO: 0016645 oxidoreductase activity, acting on the CH-NH group of donors, 0055114 oxidation-reduction process; PDB: 2E58_D 3SGL_A 3PVC_A 3AWI_D 3PS9_A 2QY6_A.
Probab=46.18  E-value=6.6  Score=28.66  Aligned_cols=16  Identities=44%  Similarity=0.862  Sum_probs=12.6

Q ss_pred             CCCccCcccCCCCCCC
Q 033199           73 VDGYSPIYNENDWSPS   88 (125)
Q Consensus        73 VDgYSPIY~p~~ws~~   88 (125)
                      -||+||-=|||-|++.
T Consensus        56 lDgFsP~~nPelWs~e   71 (124)
T PF05430_consen   56 LDGFSPAKNPELWSEE   71 (124)
T ss_dssp             E-SS-TTTSGGGSSHH
T ss_pred             ecCCCCcCCcccCCHH
Confidence            4899999999999975


No 8  
>CHL00082 psbZ photosystem II protein Z
Probab=37.92  E-value=33  Score=23.52  Aligned_cols=23  Identities=22%  Similarity=0.606  Sum_probs=16.1

Q ss_pred             cCCCCCCCCCeeccChhHHHHHHHHH
Q 033199           81 NENDWSPSGDVYTGGATGLAIWAVTL  106 (125)
Q Consensus        81 ~p~~ws~~GD~Y~gg~~gL~~wA~tl  106 (125)
                      +||+|+++-+..--|   ..+|..++
T Consensus        29 sp~~W~~sK~~v~~g---~~~W~~LV   51 (62)
T CHL00082         29 SPDGWSSNKNVVFSG---TSLWIGLV   51 (62)
T ss_pred             CCCcchhhcceeeeH---HHHHHHHH
Confidence            699999887765553   66776543


No 9  
>TIGR03043 PS_II_psbZ photosystem II core protein PsbZ. PsbZ is a core protein of photosystem II in thylakoid-containing Cyanobacteria and plant chloroplasts. The original Chlamydomonas gene symbol, ycf9, is a synonym. PsbZ controls the interaction of the reaction center core with the light-harvesting antenna.
Probab=36.06  E-value=32  Score=23.32  Aligned_cols=23  Identities=22%  Similarity=0.534  Sum_probs=16.9

Q ss_pred             cCCCCCCCCCeeccChhHHHHHHHHH
Q 033199           81 NENDWSPSGDVYTGGATGLAIWAVTL  106 (125)
Q Consensus        81 ~p~~ws~~GD~Y~gg~~gL~~wA~tl  106 (125)
                      +||+|+++-+..--|   ..+|..++
T Consensus        26 sp~~W~~sK~~i~~g---~~~W~~LV   48 (58)
T TIGR03043        26 SPGGWSRSKNLIFSG---AGLWFGLV   48 (58)
T ss_pred             CCCcchhccceeeeH---HHHHHHHH
Confidence            799999987766553   67786554


No 10 
>PRK02576 psbZ photosystem II reaction center protein Z; Provisional
Probab=35.89  E-value=32  Score=23.61  Aligned_cols=23  Identities=17%  Similarity=0.536  Sum_probs=16.6

Q ss_pred             cCCCCCCCCCeeccChhHHHHHHHHH
Q 033199           81 NENDWSPSGDVYTGGATGLAIWAVTL  106 (125)
Q Consensus        81 ~p~~ws~~GD~Y~gg~~gL~~wA~tl  106 (125)
                      +||+|+++-+..--|   ..+|..++
T Consensus        29 sp~gW~~sK~~v~~g---~~lW~~LV   51 (62)
T PRK02576         29 SPQNWGQSKRLILLG---SGVWVALV   51 (62)
T ss_pred             CCCccccccceeeeH---HHHHHHHH
Confidence            699999887766553   66776554


No 11 
>PRK13190 putative peroxiredoxin; Provisional
Probab=35.66  E-value=45  Score=25.25  Aligned_cols=53  Identities=17%  Similarity=0.266  Sum_probs=36.4

Q ss_pred             cceeEEEEecceeeeccccccCCCccccc-----chhhhhhhhcCCCCCccCcccCCCCCCCCCeec
Q 033199           32 KTSFKIVAKGGKIKTDKPYGVNGGMDLRE-----GVYQFVDKYGANVDGYSPIYNENDWSPSGDVYT   93 (125)
Q Consensus        32 R~s~~v~Asg~Kikt~~P~G~~Ggm~~k~-----Gvyqf~~KyGANVDgYSPIY~p~~ws~~GD~Y~   93 (125)
                      |..| |+...+||+-...+-..+|.+..+     -.+|+++|+|        .-+|-+|.|..|+-.
T Consensus       118 p~~f-iId~~G~I~~~~~~~~~~gr~~~ellr~l~~l~~~~~~~--------~~~p~~w~~g~~~~~  175 (202)
T PRK13190        118 RGVF-IIDPNQIVRWMIYYPAETGRNIDEIIRITKALQVNWKRK--------VATPANWQPGQEGIV  175 (202)
T ss_pred             eEEE-EECCCCEEEEEEEeCCCCCCCHHHHHHHHHHhhhHHhcC--------CCcCCCCCcCCceec
Confidence            5555 556666887666566666766555     5578888875        457999999777644


No 12 
>PRK10144 formate-dependent nitrite reductase complex subunit NrfF; Provisional
Probab=35.16  E-value=23  Score=26.84  Aligned_cols=38  Identities=26%  Similarity=0.483  Sum_probs=25.2

Q ss_pred             hhhhhhhcCCCCCccCcccCCCCCCCCCeeccChhHHHHHHHHHHHHhhhcee
Q 033199           63 YQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGAL  115 (125)
Q Consensus        63 yqf~~KyGANVDgYSPIY~p~~ws~~GD~Y~gg~~gL~~wA~tl~glL~~Gal  115 (125)
                      =-|+++||--| =|.|-+++.              .+++|++-++.++++|++
T Consensus        81 ~~~v~RYG~~V-l~~Pp~~~~--------------t~~LW~~P~~lll~g~~~  118 (126)
T PRK10144         81 GWMTERYGDFV-RYNPPLTGQ--------------TLVLWALPVVLLLLMALI  118 (126)
T ss_pred             HHHHHhcCCeE-EecCCCCcc--------------hHHHHHHHHHHHHHHHHH
Confidence            34789998655 366655543              478998877766665543


No 13 
>PF08576 DUF1764:  Eukaryotic protein of unknown function (DUF1764);  InterPro: IPR013885  This entry consists of eukaryotic proteins of unknown function, including many hypothetical proteins. 
Probab=34.55  E-value=11  Score=26.40  Aligned_cols=23  Identities=39%  Similarity=0.749  Sum_probs=14.9

Q ss_pred             CCCCccCcccCCCCCCCCCeeccCh
Q 033199           72 NVDGYSPIYNENDWSPSGDVYTGGA   96 (125)
Q Consensus        72 NVDgYSPIY~p~~ws~~GD~Y~gg~   96 (125)
                      -+||| |||+.||-.- |....|+|
T Consensus        69 teDGl-~IYt~eEL~i-g~~~gG~T   91 (102)
T PF08576_consen   69 TEDGL-PIYTEEELGI-GNPKGGGT   91 (102)
T ss_pred             cCCCc-eEecHHHhCC-CCCCCCCC
Confidence            36787 8999998773 33333443


No 14 
>COG4121 Uncharacterized conserved protein [Function unknown]
Probab=34.00  E-value=12  Score=31.05  Aligned_cols=16  Identities=31%  Similarity=0.868  Sum_probs=14.3

Q ss_pred             CCCccCcccCCCCCCC
Q 033199           73 VDGYSPIYNENDWSPS   88 (125)
Q Consensus        73 VDgYSPIY~p~~ws~~   88 (125)
                      -||+||.-|||-|+++
T Consensus       174 lDgFsP~kNP~mW~~e  189 (252)
T COG4121         174 LDGFRPVKNPEMWEDE  189 (252)
T ss_pred             cCCccccCChhhccHH
Confidence            4999999999999874


No 15 
>PF10417 1-cysPrx_C:  C-terminal domain of 1-Cys peroxiredoxin;  InterPro: IPR019479  This entry represents the C-terminal domain of 1-Cys peroxiredoxin, a member of the peroxiredoxin superfamily which protect cells against membrane oxidation through glutathione (GSH)-dependent reduction of phospholipid hydroperoxides to corresponding alcohols []. The C-terminal domain is crucial for providing the extra cysteine necessary for dimerisation of the whole molecule. Loss of the enzyme's peroxidase activity is associated with oxidation of the catalytic cysteine found upstream of this domain. Glutathionylation, presumably through its disruption of protein structure, facilitates access for GSH, resulting in spontaneous reduction of the mixed disulphide to the sulphydryl and consequent activation of the enzyme []. The domain is associated with IPR000866 from INTERPRO, which carries the catalytic cysteine. ; GO: 0051920 peroxiredoxin activity, 0055114 oxidation-reduction process; PDB: 1ZOF_E 2H01_A 3EMP_D 1YF1_G 1YF0_D 1N8J_C 1YEP_D 1YEX_D 2V41_H 2V32_C ....
Probab=33.42  E-value=41  Score=20.42  Aligned_cols=22  Identities=41%  Similarity=0.782  Sum_probs=16.9

Q ss_pred             hhhhhhhcCCCCCccCcccCCCCCCCCCee
Q 033199           63 YQFVDKYGANVDGYSPIYNENDWSPSGDVY   92 (125)
Q Consensus        63 yqf~~KyGANVDgYSPIY~p~~ws~~GD~Y   92 (125)
                      +||.||+|.        -+|..|.|.-|+-
T Consensus         2 LQ~~d~~~v--------~tPanW~pGd~~i   23 (40)
T PF10417_consen    2 LQFTDKHGV--------ATPANWKPGDDVI   23 (40)
T ss_dssp             HHHHHHHSS--------BBCTTTCTTSGEB
T ss_pred             ceehhhhCc--------ccCcCCCCCCCeE
Confidence            689999963        5899999866654


No 16 
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=31.44  E-value=30  Score=26.25  Aligned_cols=38  Identities=24%  Similarity=0.385  Sum_probs=25.6

Q ss_pred             hhhhhhhcCCCCCccCcccCCCCCCCCCeeccChhHHHHHHHHHHHHhhhcee
Q 033199           63 YQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGAL  115 (125)
Q Consensus        63 yqf~~KyGANVDgYSPIY~p~~ws~~GD~Y~gg~~gL~~wA~tl~glL~~Gal  115 (125)
                      =-|+++||--| =|.|-+++.              .+++|.+-++.++.++++
T Consensus        81 ~~~v~RYG~~V-ly~Pp~~~~--------------t~~LW~~P~lll~~G~~~  118 (126)
T TIGR03147        81 DFMTARFGDFV-LYNPPFKWQ--------------TLLLWLLPVLLLLLAFVL  118 (126)
T ss_pred             HHHHHhcCCeE-EecCCCCcc--------------hHHHHHHHHHHHHHHHHH
Confidence            34799998655 366665543              478998877776665544


No 17 
>PF13163 DUF3999:  Protein of unknown function (DUF3999)
Probab=28.86  E-value=35  Score=29.33  Aligned_cols=22  Identities=14%  Similarity=0.297  Sum_probs=18.6

Q ss_pred             hhHHHHHHHHHHHHhhhceeee
Q 033199           96 ATGLAIWAVTLAGLLAGGALLV  117 (125)
Q Consensus        96 ~~gL~~wA~tl~glL~~Gallv  117 (125)
                      .+-+++|+++++|++..|.+..
T Consensus       406 ~~~~~LW~~Lv~gV~vL~~mA~  427 (429)
T PF13163_consen  406 WKRWLLWGALVLGVAVLGGMAW  427 (429)
T ss_pred             hhhhHHHHHHHHHHHHHHHHhe
Confidence            5678999999999999887654


No 18 
>PRK15006 thiosulfate reductase cytochrome B subunit; Provisional
Probab=26.06  E-value=46  Score=26.87  Aligned_cols=16  Identities=25%  Similarity=0.792  Sum_probs=12.9

Q ss_pred             CCCCCccCcccCCCCC
Q 033199           71 ANVDGYSPIYNENDWS   86 (125)
Q Consensus        71 ANVDgYSPIY~p~~ws   86 (125)
                      +..-+|-|.|+||-|-
T Consensus        12 ~~~~~~~~~~~~~~~~   27 (261)
T PRK15006         12 SQLANYVPQYTPDYWP   27 (261)
T ss_pred             HHHhcccccCCccccH
Confidence            3456899999999995


No 19 
>PF13179 DUF4006:  Family of unknown function (DUF4006)
Probab=24.14  E-value=75  Score=22.10  Aligned_cols=21  Identities=38%  Similarity=0.365  Sum_probs=17.1

Q ss_pred             cChhHHHHHHHHHHHHhhhce
Q 033199           94 GGATGLAIWAVTLAGLLAGGA  114 (125)
Q Consensus        94 gg~~gL~~wA~tl~glL~~Ga  114 (125)
                      -|.+|.+|--++|+.+|++..
T Consensus        11 nGi~G~LIAvvLLLsIl~~lt   31 (66)
T PF13179_consen   11 NGITGMLIAVVLLLSILAFLT   31 (66)
T ss_pred             cchHhHHHHHHHHHHHHHHHH
Confidence            378899999999988887654


No 20 
>PF02388 FemAB:  FemAB family;  InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan []. These proteins are also considered as a factor influencing the level of methicillin resistance [].; GO: 0016755 transferase activity, transferring amino-acyl groups; PDB: 1XE4_A 1NE9_A 3GKR_A 1XIX_A 1P4N_A 1XF8_A 1LRZ_A.
Probab=22.11  E-value=28  Score=29.38  Aligned_cols=31  Identities=26%  Similarity=0.637  Sum_probs=22.6

Q ss_pred             cccCCCccccc---chhhhhhhhcCCCCCccCcc
Q 033199           50 YGVNGGMDLRE---GVYQFVDKYGANVDGYSPIY   80 (125)
Q Consensus        50 ~G~~Ggm~~k~---Gvyqf~~KyGANVDgYSPIY   80 (125)
                      +|+.|..+-.+   |+|+|=.++|.++..|-+-|
T Consensus       356 ~Gi~~~~~~~~~~~Gl~~FK~~F~g~~~e~~G~f  389 (406)
T PF02388_consen  356 GGISGDFDGSDPDYGLYKFKKGFGGQIVEYIGEF  389 (406)
T ss_dssp             EE-SSSSTTTHTTHHHHHHHHCCT-CEEEE--EE
T ss_pred             eCCCCCCCCCcccchHHHHhhcCCCcEEEeeeeE
Confidence            68888776655   99999999999998887644


No 21 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=20.86  E-value=50  Score=24.77  Aligned_cols=34  Identities=24%  Similarity=0.239  Sum_probs=19.0

Q ss_pred             CCCCCCCeeccChhHHHHHHHHHHHHhhhceeeee
Q 033199           84 DWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVY  118 (125)
Q Consensus        84 ~ws~~GD~Y~gg~~gL~~wA~tl~glL~~Gallvy  118 (125)
                      +.++.-..+.+|...++++.+ ++|+++.-+|+.|
T Consensus        53 ~~~ql~h~fs~~~i~~Ii~gv-~aGvIg~Illi~y   86 (122)
T PF01102_consen   53 ERSQLVHRFSEPAIIGIIFGV-MAGVIGIILLISY   86 (122)
T ss_dssp             ---SSSSSSS-TCHHHHHHHH-HHHHHHHHHHHHH
T ss_pred             CCcccccCccccceeehhHHH-HHHHHHHHHHHHH
Confidence            445555567777777777665 4566666666555


Done!