Query         033207
Match_columns 125
No_of_seqs    71 out of 73
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 11:07:46 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033207.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033207hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0578 p21-activated serine/t  71.4     2.3 4.9E-05   39.4   1.5   22  104-125   411-436 (550)
  2 PF12674 Zn_ribbon_2:  Putative  59.1      12 0.00027   26.0   3.0   29   69-97     41-70  (81)
  3 COG2166 sufE Cysteine desulfur  56.5      21 0.00046   27.8   4.2   40   49-88     51-95  (144)
  4 PF13961 DUF4219:  Domain of un  55.4     0.9   2E-05   25.8  -2.6   14   51-64      1-14  (27)
  5 PF05922 Inhibitor_I9:  Peptida  54.0      23 0.00049   22.3   3.4   61   60-123     3-69  (82)
  6 PF10847 DUF2656:  Protein of u  51.9      24 0.00052   27.5   3.8   31   55-88     41-71  (132)
  7 TIGR03868 F420-O_ABCperi propo  49.7      17 0.00036   28.1   2.7   26   71-97    126-151 (287)
  8 cd01148 TroA_a Metal binding p  48.2      23  0.0005   27.3   3.2   24   71-95    124-147 (284)
  9 cd01143 YvrC Periplasmic bindi  44.0      20 0.00043   25.6   2.2   20   77-96     98-117 (195)
 10 COG0614 FepB ABC-type Fe3+-hyd  43.1      15 0.00033   28.1   1.5   22   76-97    151-172 (319)
 11 cd01144 BtuF Cobalamin binding  42.2      16 0.00034   27.4   1.5   23   72-95     91-113 (245)
 12 TIGR00013 taut 4-oxalocrotonat  40.0      32  0.0007   21.1   2.4   43   69-111    14-56  (63)
 13 PRK02220 4-oxalocrotonate taut  39.3      47   0.001   20.3   3.1   43   69-111    14-56  (61)
 14 PRK10576 iron-hydroxamate tran  39.1      52  0.0011   26.0   4.0   23   73-95    128-150 (292)
 15 cd01139 TroA_f Periplasmic bin  38.5      49  0.0011   26.4   3.8   24   71-95    130-153 (342)
 16 cd01147 HemV-2 Metal binding p  37.7      28 0.00061   26.1   2.2   20   76-95    113-132 (262)
 17 cd00491 4Oxalocrotonate_Tautom  35.8      50  0.0011   19.8   2.8   41   69-109    13-53  (58)
 18 KOG1684 Enoyl-CoA hydratase [L  35.8      73  0.0016   28.8   4.8   97    1-111     1-99  (401)
 19 KOG4079 Putative mitochondrial  35.7      21 0.00044   28.7   1.2   40   69-111    93-135 (169)
 20 KOG1257 NADP+-dependent malic   35.3      38 0.00083   31.9   3.1   25   78-103   328-353 (582)
 21 PF01497 Peripla_BP_2:  Peripla  34.5      81  0.0018   23.1   4.2   23   74-96     96-118 (238)
 22 PRK02260 S-ribosylhomocysteina  33.6      61  0.0013   25.6   3.6   31   53-87     81-111 (158)
 23 PRK11411 fecB iron-dicitrate t  33.2      63  0.0014   25.6   3.7   24   71-95    134-157 (303)
 24 PF08006 DUF1700:  Protein of u  32.0      57  0.0012   24.5   3.1   23   71-93     21-46  (181)
 25 PF10850 DUF2653:  Protein of u  31.9      67  0.0015   23.5   3.3   41   70-113     5-46  (91)
 26 TIGR01542 A118_put_portal phag  31.6      51  0.0011   29.6   3.2   42   60-101   413-455 (476)
 27 cd01149 HutB Hemin binding pro  31.3      52  0.0011   24.7   2.8   20   76-95     96-115 (235)
 28 cd01142 TroA_e Periplasmic bin  30.5      47   0.001   25.6   2.5   22   75-96    122-143 (289)
 29 TIGR03659 IsdE heme ABC transp  30.5      48   0.001   26.1   2.5   22   74-95    125-146 (289)
 30 PHA01078 putative upper collar  30.4      63  0.0014   27.5   3.3   42   49-90     52-93  (249)
 31 cd01146 FhuD Fe3+-siderophore   30.1      79  0.0017   23.9   3.6   23   71-94     97-119 (256)
 32 PRK03379 vitamin B12-transport  29.0      45 0.00097   26.1   2.1   20   76-95    109-128 (260)
 33 cd04438 DEP_dishevelled DEP (D  28.4      20 0.00044   24.9   0.1   50   46-106    25-74  (84)
 34 PF02902 Peptidase_C48:  Ulp1 p  27.8      83  0.0018   22.9   3.3   30   73-102     5-34  (216)
 35 COG4607 CeuA ABC-type enteroch  27.8      34 0.00074   30.0   1.4   19   80-98    159-177 (320)
 36 PTZ00397 macrophage migration   27.3 1.4E+02  0.0031   20.7   4.3   48   60-107     5-52  (116)
 37 PRK01964 4-oxalocrotonate taut  26.8      83  0.0018   19.7   2.7   42   69-110    14-55  (64)
 38 PF01361 Tautomerase:  Tautomer  26.4      91   0.002   19.1   2.8   33   61-93      3-37  (60)
 39 cd01140 FatB Siderophore bindi  26.2      64  0.0014   24.6   2.5   20   76-95    109-128 (270)
 40 PF08776 VASP_tetra:  VASP tetr  25.5      80  0.0017   20.2   2.4   15   72-86     24-38  (40)
 41 PRK10957 iron-enterobactin tra  25.1      59  0.0013   25.8   2.2   18   78-95    152-169 (317)
 42 PF02664 LuxS:  S-Ribosylhomocy  24.8 1.1E+02  0.0024   24.3   3.6   34   53-90     81-114 (157)
 43 cd00636 TroA-like Helical back  24.8      69  0.0015   20.6   2.1   25   73-97     97-121 (148)
 44 PF14581 SseB_C:  SseB protein   24.2 1.6E+02  0.0036   20.1   4.1   35   53-89     45-79  (108)
 45 PF01026 TatD_DNase:  TatD rela  23.4 1.1E+02  0.0024   23.9   3.4   48   52-99    193-248 (255)
 46 cd00126 PAH Pancreatic Hormone  23.3      94   0.002   19.2   2.4   18   64-81      6-23  (36)
 47 cd00762 NAD_bind_malic_enz NAD  23.0      91   0.002   26.1   3.0   16   88-103    52-68  (254)
 48 TIGR03391 FeS_syn_CsdE cystein  22.7 2.3E+02  0.0049   21.5   4.8   46   49-94     51-103 (138)
 49 PRK14048 ferrichrome/ferrioxam  22.7      71  0.0015   26.2   2.3   19   78-96    166-184 (374)
 50 PF11767 SET_assoc:  Histone ly  22.2      29 0.00063   23.5  -0.0   24   86-109    39-62  (66)
 51 COG4594 FecB ABC-type Fe3+-cit  22.0      70  0.0015   28.0   2.2   28   69-97    142-169 (310)
 52 COG1854 LuxS LuxS protein invo  21.7 1.8E+02  0.0038   23.5   4.2   32   53-88     81-112 (161)
 53 TIGR02778 ligD_pol DNA polymer  21.5      83  0.0018   26.3   2.5   22   65-86     11-32  (245)
 54 cd01138 FeuA Periplasmic bindi  21.1      90   0.002   23.4   2.4   22   73-95     97-118 (248)
 55 PF07105 DUF1367:  Protein of u  21.0      78  0.0017   26.0   2.2   34   53-90     55-90  (196)
 56 TIGR02145 Fib_succ_major Fibro  20.9      54  0.0012   25.5   1.2   36   57-97     50-89  (171)
 57 KOG4420 Uncharacterized conser  20.5      65  0.0014   28.4   1.7   74   49-122    58-152 (325)
 58 PRK15019 CsdA-binding activato  20.2 2.6E+02  0.0057   21.5   4.8   46   49-94     56-108 (147)

No 1  
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]
Probab=71.36  E-value=2.3  Score=39.36  Aligned_cols=22  Identities=18%  Similarity=0.297  Sum_probs=20.0

Q ss_pred             eeeeeeeeeehhhc----cccCCCCC
Q 033207          104 YYYAFGCKFLKILL----IRSDPYQM  125 (125)
Q Consensus       104 ~yfgF~c~I~Ee~S----lk~lP~~~  125 (125)
                      +.||||+.|+|+-+    +-+-||-|
T Consensus       411 tDFGFcaqi~~~~~KR~TmVGTPYWM  436 (550)
T KOG0578|consen  411 TDFGFCAQISEEQSKRSTMVGTPYWM  436 (550)
T ss_pred             eeeeeeeccccccCccccccCCCCcc
Confidence            78999999999997    88899987


No 2  
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=59.10  E-value=12  Score=26.02  Aligned_cols=29  Identities=21%  Similarity=0.225  Sum_probs=25.1

Q ss_pred             CCChHHHHHHHHHHHHHHhC-CHHHhhccc
Q 033207           69 YPPRDEIVNGYVKTLASALG-CEEDAKKSI   97 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLG-SeeEAkkkI   97 (125)
                      ..|.+|||+.-++-+++.-| ++|||++.+
T Consensus        41 ~~t~eemie~~~~~~~~~~~~~~~~a~~~~   70 (81)
T PF12674_consen   41 DITMEEMIEFCVPFMDEFNGMTPEEARKMM   70 (81)
T ss_pred             cCCHHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence            46999999999999999987 899998643


No 3  
>COG2166 sufE Cysteine desulfurase SufE subunit [Posttranslational modification, protein turnover, chaperones]
Probab=56.54  E-value=21  Score=27.82  Aligned_cols=40  Identities=28%  Similarity=0.511  Sum_probs=34.8

Q ss_pred             cccCCCCcceeEEEeeCCCC-----CCChHHHHHHHHHHHHHHhC
Q 033207           49 SLLEGCDYKHWLVVMEAPKG-----YPPRDEIVNGYVKTLASALG   88 (125)
Q Consensus        49 ~L~~Gcdy~HWLVvMe~P~g-----~~sr~emId~Yv~TLAkVLG   88 (125)
                      -...||...-|++..-..+|     ..|.+.||..++.+|..++.
T Consensus        51 n~V~GC~S~vwL~~~~~~~~~~~F~gdSdA~ivrGL~aill~~~~   95 (144)
T COG2166          51 NPVPGCQSQVWLVTEQNDDGTLHFFGDSDARIVRGLLAILLAAYS   95 (144)
T ss_pred             cCCCccccceeEEEeecCCceEEEeccchhHHHHHHHHHHHHHHc
Confidence            46689999999998877654     68999999999999999883


No 4  
>PF13961 DUF4219:  Domain of unknown function (DUF4219)
Probab=55.43  E-value=0.9  Score=25.79  Aligned_cols=14  Identities=36%  Similarity=0.983  Sum_probs=12.3

Q ss_pred             cCCCCcceeEEEee
Q 033207           51 LEGCDYKHWLVVME   64 (125)
Q Consensus        51 ~~Gcdy~HWLVvMe   64 (125)
                      |+|-+|.+|-+.|.
T Consensus         1 l~g~NY~~W~~~M~   14 (27)
T PF13961_consen    1 LDGTNYSTWKIRMK   14 (27)
T ss_pred             CCccCHHHHHHHHH
Confidence            78999999988886


No 5  
>PF05922 Inhibitor_I9:  Peptidase inhibitor I9;  InterPro: IPR010259 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  Limited proteolysis of most large protein precursors is carried out in vivo by the subtilisin-like pro-protein convertases. Many important biological processes such as peptide hormone synthesis, viral protein processing and receptor maturation involve proteolytic processing by these enzymes []. The subtilisin-serine protease (SRSP) family hormone and pro-protein convertases (furin, PC1/3, PC2, PC4, PACE4, PC5/6, and PC7/7/LPC) act within the secretory pathway to cleave polypeptide precursors at specific basic sites, generating their biologically active forms. Serum proteins, pro-hormones, receptors, zymogens, viral surface glycoproteins, bacterial toxins, amongst others, are activated by this route []. The SRSPs share the same domain structure, including a signal peptide, the pro-peptide, the catalytic domain, the P/middle or homo B domain, and the C terminus. Proteinase propeptide inhibitors (sometimes refered to as activation peptides) are responsible for the modulation of folding and activity of the pro-enzyme or zymogen. The pro-segment docks into the enzyme moiety shielding the substrate binding site, thereby promoting inhibition of the enzyme. Several such propeptides share a similar topology [], despite often low sequence identities []. The propeptide region has an open-sandwich antiparallel-alpha/antiparallel-beta fold, with two alpha-helices and four beta-strands with a (beta/alpha/beta)x2 topology. This group of sequences contain the propeptide domain at the N terminus of peptidases belonging to MEROPS family S8A, subtilisins. A number of the members of this group of sequences belong to MEROPS inhibitor family I9, clan I-. The propeptide is removed by proteolytic cleavage; removal activating the enzyme.; GO: 0004252 serine-type endopeptidase activity, 0042802 identical protein binding, 0043086 negative regulation of catalytic activity; PDB: 3CNQ_P 1SPB_P 3CO0_P 1ITP_A 1V5I_B 1SCJ_B 3P5B_P 2XTJ_P 2W2M_P 2P4E_P ....
Probab=54.02  E-value=23  Score=22.35  Aligned_cols=61  Identities=16%  Similarity=0.194  Sum_probs=30.1

Q ss_pred             EEEeeCCCCCCChHHHHHHHHHHHHHHhCC----HHHhhccceEEeeceeeeeeeeeehhhc--cccCCC
Q 033207           60 LVVMEAPKGYPPRDEIVNGYVKTLASALGC----EEDAKKSIYSVSTKYYYAFGCKFLKILL--IRSDPY  123 (125)
Q Consensus        60 LVvMe~P~g~~sr~emId~Yv~TLAkVLGS----eeEAkkkIY~vSt~~yfgF~c~I~Ee~S--lk~lP~  123 (125)
                      .|+|+.+..   .++..+.-.+-.+..+.+    ....+-++-..-...--||-+.++++.-  |+.+|-
T Consensus         3 IV~~k~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~Gfs~~l~~~~i~~L~~~p~   69 (82)
T PF05922_consen    3 IVVFKDDAS---AASSFSSHKSWQASILKSALKSASSINAKVLYSYDNAFNGFSAKLSEEEIEKLRKDPG   69 (82)
T ss_dssp             EEEE-TTST---HHCHHHHHHHHHH----HHHHTH-TTT-EEEEEESSTSSEEEEEE-HHHHHHHHTSTT
T ss_pred             EEEECCCCC---cchhHHHHHHHHHHHHhhhhhhhcccCCceEEEEeeeEEEEEEEeCHHHHHHHHcCCC
Confidence            677876533   222344444444433332    1233444444333367899999999887  877773


No 6  
>PF10847 DUF2656:  Protein of unknown function (DUF2656);  InterPro: IPR020325 This entry contains uncharacterised proteins from the cpeY 3'-region. They have no known function, but are found in the phycobilisome.
Probab=51.93  E-value=24  Score=27.49  Aligned_cols=31  Identities=23%  Similarity=0.405  Sum_probs=26.3

Q ss_pred             CcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhC
Q 033207           55 DYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALG   88 (125)
Q Consensus        55 dy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLG   88 (125)
                      +-.||||-++   ...|++||-...++++.+.=-
T Consensus        41 ~hPHW~v~i~---s~lsp~~~~~~~v~aw~~~R~   71 (132)
T PF10847_consen   41 NHPHWMVEIE---SDLSPDEMAEELVRAWKQYRN   71 (132)
T ss_pred             cCCceEEEec---ccCCHHHHHHHHHHHHHHHHH
Confidence            6679999998   778999999999999887643


No 7  
>TIGR03868 F420-O_ABCperi proposed F420-0 ABC transporter, periplasmic F420-0 binding protein. This small clade of ABC-type transporter periplasmic binding protein components is found as a three gene cassette along with a permease (TIGR03869) and an ATPase (TIGR03873). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this periplasmic binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=49.74  E-value=17  Score=28.10  Aligned_cols=26  Identities=8%  Similarity=0.253  Sum_probs=19.2

Q ss_pred             ChHHHHHHHHHHHHHHhCCHHHhhccc
Q 033207           71 PRDEIVNGYVKTLASALGCEEDAKKSI   97 (125)
Q Consensus        71 sr~emId~Yv~TLAkVLGSeeEAkkkI   97 (125)
                      +.+++.+. ++.|++++|.|++|++-|
T Consensus       126 ~~~~~~~~-i~~lg~~~g~e~~A~~~i  151 (287)
T TIGR03868       126 TFDDVFAE-ITEVGTIFDVPDAAASLV  151 (287)
T ss_pred             CHHHHHHH-HHHHHHHhCCHHHHHHHH
Confidence            45555554 788999999999887643


No 8  
>cd01148 TroA_a Metal binding protein TroA_a.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=48.16  E-value=23  Score=27.29  Aligned_cols=24  Identities=25%  Similarity=0.454  Sum_probs=15.4

Q ss_pred             ChHHHHHHHHHHHHHHhCCHHHhhc
Q 033207           71 PRDEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        71 sr~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      +.+++.+ .++.+++++|.||+|++
T Consensus       124 ~~~~~~~-~~~~lg~~~g~e~~A~~  147 (284)
T cd01148         124 TLDDVYN-DIRNLGKIFDVEDRADK  147 (284)
T ss_pred             CHHHHHH-HHHHHHHHhCCHhHHHH
Confidence            4444444 57778888887776653


No 9  
>cd01143 YvrC Periplasmic binding protein YvrC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria and archaea.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=43.98  E-value=20  Score=25.61  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHhCCHHHhhcc
Q 033207           77 NGYVKTLASALGCEEDAKKS   96 (125)
Q Consensus        77 d~Yv~TLAkVLGSeeEAkkk   96 (125)
                      .-.+++|++++|.+|+|++-
T Consensus        98 ~~~~~~lg~~~g~~~~a~~~  117 (195)
T cd01143          98 YDQIELIGKITGAEEEAEKL  117 (195)
T ss_pred             HHHHHHHHHHhCChHHHHHH
Confidence            33577889999988887663


No 10 
>COG0614 FepB ABC-type Fe3+-hydroxamate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=43.09  E-value=15  Score=28.14  Aligned_cols=22  Identities=36%  Similarity=0.533  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHhCCHHHhhccc
Q 033207           76 VNGYVKTLASALGCEEDAKKSI   97 (125)
Q Consensus        76 Id~Yv~TLAkVLGSeeEAkkkI   97 (125)
                      +.-=++++++++|.|++|++-|
T Consensus       151 ~~~~i~~lg~~~g~e~~A~~li  172 (319)
T COG0614         151 IKEQIRLLGKALGKEEKAEELI  172 (319)
T ss_pred             HHHHHHHHHHHhCcHHHHHHHH
Confidence            3344688999999999997644


No 11 
>cd01144 BtuF Cobalamin binding protein BtuF.  These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=42.15  E-value=16  Score=27.37  Aligned_cols=23  Identities=22%  Similarity=0.382  Sum_probs=17.3

Q ss_pred             hHHHHHHHHHHHHHHhCCHHHhhc
Q 033207           72 RDEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        72 r~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      .+++. --+++||+++|.+++|++
T Consensus        91 ~~~~~-~~~~~lg~~~g~~~~a~~  113 (245)
T cd01144          91 LDDIL-ADIRRLGTLAGRPARAEE  113 (245)
T ss_pred             HHHHH-HHHHHHHHHhCChhHHHH
Confidence            33433 468899999999998854


No 12 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=40.01  E-value=32  Score=21.14  Aligned_cols=43  Identities=19%  Similarity=0.350  Sum_probs=30.7

Q ss_pred             CCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceeeeeeee
Q 033207           69 YPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYAFGCK  111 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yfgF~c~  111 (125)
                      .-.|++++..-.+.|+++||.-+|.-.-+..-.-...||||=.
T Consensus        14 ~eqK~~l~~~it~~l~~~lg~~~~~v~V~i~e~~~~~w~~gG~   56 (63)
T TIGR00013        14 DEQKRQLIEGVTEAMAETLGANLESIVVIIDEMPKNNYGIGGE   56 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCcccEEEEEEEcCHHHeeECCE
Confidence            4578889999999999999966665554445555566777643


No 13 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=39.27  E-value=47  Score=20.33  Aligned_cols=43  Identities=19%  Similarity=0.224  Sum_probs=32.6

Q ss_pred             CCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceeeeeeee
Q 033207           69 YPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYAFGCK  111 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yfgF~c~  111 (125)
                      .-.|.++++.-.+.|++++|...|.-.-+..---...||||=.
T Consensus        14 ~eqk~~l~~~it~~l~~~~~~p~~~v~V~i~e~~~~~~~~gG~   56 (61)
T PRK02220         14 EEQLKALVKDVTAAVSKNTGAPAEHIHVIINEMSKNHYAVGGK   56 (61)
T ss_pred             HHHHHHHHHHHHHHHHHHhCcChhhEEEEEEEeChhHeEECCE
Confidence            4577889999999999999976766666666666667777643


No 14 
>PRK10576 iron-hydroxamate transporter substrate-binding subunit; Provisional
Probab=39.11  E-value=52  Score=26.04  Aligned_cols=23  Identities=22%  Similarity=0.182  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHhCCHHHhhc
Q 033207           73 DEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        73 ~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      -+.+..-++.|++++|.|++|++
T Consensus       128 ~~~~~~~i~~lg~ilG~e~~A~~  150 (292)
T PRK10576        128 LAVARKSLVELAQRLNLEAAAET  150 (292)
T ss_pred             HHHHHHHHHHHHHHhCCHHHHHH
Confidence            45667778999999999988754


No 15 
>cd01139 TroA_f Periplasmic binding protein TroA_f.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=38.48  E-value=49  Score=26.39  Aligned_cols=24  Identities=33%  Similarity=0.466  Sum_probs=16.8

Q ss_pred             ChHHHHHHHHHHHHHHhCCHHHhhc
Q 033207           71 PRDEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        71 sr~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      +-+++.+ -++.|++++|.+++|++
T Consensus       130 ~~~~~~~-~i~~lg~i~g~~~~A~~  153 (342)
T cd01139         130 PLKNTTP-SMRLLGKALGREERAEE  153 (342)
T ss_pred             hhhhHHH-HHHHHHHHhCCHHHHHH
Confidence            3445554 47789999998887754


No 16 
>cd01147 HemV-2 Metal binding protein HemV-2.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=37.72  E-value=28  Score=26.14  Aligned_cols=20  Identities=30%  Similarity=0.423  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHhCCHHHhhc
Q 033207           76 VNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        76 Id~Yv~TLAkVLGSeeEAkk   95 (125)
                      +...++.|++++|.+++|++
T Consensus       113 ~~~~i~~lg~~~g~~~~a~~  132 (262)
T cd01147         113 TPEQIRLLGKVLGKEERAEE  132 (262)
T ss_pred             HHHHHHHHHHHhCCHHHHHH
Confidence            35677899999999888774


No 17 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=35.83  E-value=50  Score=19.78  Aligned_cols=41  Identities=17%  Similarity=0.269  Sum_probs=27.0

Q ss_pred             CCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceeeeee
Q 033207           69 YPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYAFG  109 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yfgF~  109 (125)
                      .-.|.++++.-.+.+++++|.-+|.-.-+..-.-...||||
T Consensus        13 ~eqk~~l~~~i~~~l~~~~g~~~~~v~V~i~e~~~~~~~~g   53 (58)
T cd00491          13 DEQKRELIERVTEAVSEILGAPEATIVVIIDEMPKENWGIG   53 (58)
T ss_pred             HHHHHHHHHHHHHHHHHHhCcCcccEEEEEEEeCchhceEC
Confidence            45677889999999999999655543333333444455554


No 18 
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism]
Probab=35.83  E-value=73  Score=28.84  Aligned_cols=97  Identities=22%  Similarity=0.158  Sum_probs=57.7

Q ss_pred             CchhhhhcccchhHHHHHHhhhcCCCCCCCCcceeccCC-ccccCCCCCcccCCCCcceeEEEeeCCCC-CCChHHHHHH
Q 033207            1 MLRNIILRCPLNLTAAIYRRRHLQSSSPPSSLFFFSSDS-TVTQLTRLPSLLEGCDYKHWLVVMEAPKG-YPPRDEIVNG   78 (125)
Q Consensus         1 ~~~~~~~~~pl~~~a~~~~~~~~~~~~p~s~~~~~s~~s-~~s~l~~~p~L~~Gcdy~HWLVvMe~P~g-~~sr~emId~   78 (125)
                      |+|+..+++++...-+.-  +        +..|.|++-+ .++.-..+++|++|-+... +|+.|.|+- ..=-.|||+.
T Consensus         1 m~~~~~~~~~~s~~~~~~--~--------~~~r~f~~~~~~~~~~~~~~VL~e~~~~~r-~itLNRPKaLNAlnleMv~~   69 (401)
T KOG1684|consen    1 MLRQKLLKARVSNFLALK--R--------TTSRAFIRMASSVSTDSKDQVLVEGKGCAR-VITLNRPKALNALNLEMVLS   69 (401)
T ss_pred             Ccchhhhhhhhcchhhhh--h--------hhccceeecccccccccCCceEEecCCcee-EEEecCchhhccccHHHHHH
Confidence            677777777766443332  1        1233444444 4455555889999866655 889999997 5666799999


Q ss_pred             HHHHHHHHhCCHHHhhccceEEeeceeeeeeee
Q 033207           79 YVKTLASALGCEEDAKKSIYSVSTKYYYAFGCK  111 (125)
Q Consensus        79 Yv~TLAkVLGSeeEAkkkIY~vSt~~yfgF~c~  111 (125)
                      |...|-+-= .-++++--|--=|  +..+||+-
T Consensus        70 ~~~~L~~we-~s~~~k~vIlkgs--~~raFCAG   99 (401)
T KOG1684|consen   70 IYPKLVEWE-KSPLVKLVILKGS--GGRAFCAG   99 (401)
T ss_pred             HHHHHHhhc-cCCCceEEEEecC--CCceeecC
Confidence            987664321 1122232233333  36677773


No 19 
>KOG4079 consensus Putative mitochondrial ribosomal protein mRpS25 [Translation, ribosomal structure and biogenesis]
Probab=35.65  E-value=21  Score=28.74  Aligned_cols=40  Identities=28%  Similarity=0.244  Sum_probs=25.8

Q ss_pred             CCChHHHHHHHHHHHHH---HhCCHHHhhccceEEeeceeeeeeee
Q 033207           69 YPPRDEIVNGYVKTLAS---ALGCEEDAKKSIYSVSTKYYYAFGCK  111 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAk---VLGSeeEAkkkIY~vSt~~yfgF~c~  111 (125)
                      .-+++||+++.+|||.|   +|..||+-|+   +-+--..||.+|+
T Consensus        93 ~~~r~eI~~hl~K~lGKtee~lr~Ee~ek~---~k~nPAnFG~~c~  135 (169)
T KOG4079|consen   93 GMKREEIEKHLAKTLGKTEEVLRREELEKI---AKLNPANFGSKCE  135 (169)
T ss_pred             cccHHHHHHHHHHHhCccHHHHhHHHHHHH---hhcChhhhccccc
Confidence            46899999998887765   4544444333   2345567887775


No 20 
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion]
Probab=35.32  E-value=38  Score=31.87  Aligned_cols=25  Identities=36%  Similarity=0.535  Sum_probs=18.3

Q ss_pred             HHHHHHHHHhC-CHHHhhccceEEeec
Q 033207           78 GYVKTLASALG-CEEDAKKSIYSVSTK  103 (125)
Q Consensus        78 ~Yv~TLAkVLG-SeeEAkkkIY~vSt~  103 (125)
                      --+..+.+- | +||||+||||=|.-+
T Consensus       328 l~v~~m~~~-Gl~~eeA~kkIwlvD~~  353 (582)
T KOG1257|consen  328 LIVMAMVKE-GLSEEEARKKIWLVDSK  353 (582)
T ss_pred             HHHHHHHHc-CCCHHHHhccEEEEecC
Confidence            334555555 7 999999999988644


No 21 
>PF01497 Peripla_BP_2:  Periplasmic binding protein;  InterPro: IPR002491 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Most bacterial importers employ a periplasmic substrate-binding protein (PBP) that delivers the ligand to the extracellular gate of the TM domains. These proteins bind their substrates selectively and with high affinity, which is thought to ensure the specificity of the transport reaction. Binding proteins in Gram-negative bacteria are present within the periplasm, whereas those in Gram-positive bacteria are tethered to the cell membrane via the acylation of a cysteine residue that is an integral component of a lipoprotein signal sequence. In planta expression of a high-affinity iron-uptake system involving the siderophore chrysobactin in Erwinia chrysanthemi 3937 contributes greatly to invasive growth of this pathogen on its natural host, African violets []. The cobalamin (vitamin B12) and the iron transport systems share many common attributes and probably evolved from the same origin [, ].  The periplasmic-binding domain is composed of two subdomains, each consisting of a central beta-sheet and surrounding alpha-helices, linked by a rigid alpha-helix. The substrate binding site is located in a cleft between the two alpha/beta subdomains [].; GO: 0005488 binding; PDB: 2X4L_A 1N4A_B 1N2Z_B 1N4D_B 4DBL_J 2QI9_F 3EIW_A 3EIX_A 3MWG_A 3MWF_A ....
Probab=34.50  E-value=81  Score=23.06  Aligned_cols=23  Identities=26%  Similarity=0.342  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHhCCHHHhhcc
Q 033207           74 EIVNGYVKTLASALGCEEDAKKS   96 (125)
Q Consensus        74 emId~Yv~TLAkVLGSeeEAkkk   96 (125)
                      +-+.-.++.||+++|-+++|++-
T Consensus        96 ~~~~~~i~~lg~~~g~~~~a~~~  118 (238)
T PF01497_consen   96 DDWKEQIRQLGKALGKEDQAEAL  118 (238)
T ss_dssp             HHHHHHHHHHHHHHTSHHHHHHH
T ss_pred             HHHHHHHHHHHHhcccHHHHHHH
Confidence            77778889999999999988753


No 22 
>PRK02260 S-ribosylhomocysteinase; Provisional
Probab=33.64  E-value=61  Score=25.62  Aligned_cols=31  Identities=26%  Similarity=0.672  Sum_probs=28.4

Q ss_pred             CCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHh
Q 033207           53 GCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASAL   87 (125)
Q Consensus        53 Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVL   87 (125)
                      ||.--+.||+.    |.++.+++++...++|..|+
T Consensus        81 GCrTGFYli~~----g~~~~~~i~~l~~~~l~~i~  111 (158)
T PRK02260         81 GCRTGFYLILI----GTPDEEDVADALKATLEDVL  111 (158)
T ss_pred             ccccccEEEEe----CCCCHHHHHHHHHHHHHHHH
Confidence            99999999986    56889999999999999998


No 23 
>PRK11411 fecB iron-dicitrate transporter substrate-binding subunit; Provisional
Probab=33.19  E-value=63  Score=25.58  Aligned_cols=24  Identities=13%  Similarity=0.221  Sum_probs=18.0

Q ss_pred             ChHHHHHHHHHHHHHHhCCHHHhhc
Q 033207           71 PRDEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        71 sr~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      +.++..+ .++.||+++|.|++|++
T Consensus       134 ~~~~~~~-~i~~lg~i~g~e~~a~~  157 (303)
T PRK11411        134 TYQENLQ-SAAIIGEVLGKKREMQA  157 (303)
T ss_pred             CHHHHHH-HHHHHHHHhCCHHHHHH
Confidence            5556555 35789999999988875


No 24 
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=32.05  E-value=57  Score=24.46  Aligned_cols=23  Identities=35%  Similarity=0.499  Sum_probs=15.7

Q ss_pred             ChHHHHHHHHHHHHHHh--C-CHHHh
Q 033207           71 PRDEIVNGYVKTLASAL--G-CEEDA   93 (125)
Q Consensus        71 sr~emId~Yv~TLAkVL--G-SeeEA   93 (125)
                      .++|++++|.+-.....  | ||||+
T Consensus        21 e~~e~l~~Y~e~f~d~~~~G~sEeei   46 (181)
T PF08006_consen   21 EREEILEYYEEYFDDAGEEGKSEEEI   46 (181)
T ss_pred             HHHHHHHHHHHHHHHhhhCCCCHHHH
Confidence            57889999988776543  3 55554


No 25 
>PF10850 DUF2653:  Protein of unknown function (DUF2653);  InterPro: IPR020516 This entry contains proteins with no known function.
Probab=31.95  E-value=67  Score=23.55  Aligned_cols=41  Identities=22%  Similarity=0.291  Sum_probs=27.6

Q ss_pred             CChHHHHHHHHHHHHHHhC-CHHHhhccceEEeeceeeeeeeeee
Q 033207           70 PPRDEIVNGYVKTLASALG-CEEDAKKSIYSVSTKYYYAFGCKFL  113 (125)
Q Consensus        70 ~sr~emId~Yv~TLAkVLG-SeeEAkkkIY~vSt~~yfgF~c~I~  113 (125)
                      .+.+|+|++----.|+-=| .-+|-..   ..+|+-++||+|++.
T Consensus         5 l~EqeIiNAvCl~~A~~~~i~P~dVeV---eL~yDdd~GFsAEv~   46 (91)
T PF10850_consen    5 LSEQEIINAVCLHIAERKGIQPEDVEV---ELMYDDDYGFSAEVW   46 (91)
T ss_pred             ccHHHHHHHHHHHHHHhcCCCcccEEE---EEEEecCCCeeEEEE
Confidence            3567788776555555444 3444333   789999999999873


No 26 
>TIGR01542 A118_put_portal phage portal protein, putative, A118 family. This model represents a family of phage minor structural proteins. The protein is suggested to be the head-tail connector, or portal protein, on the basis of its position in the phage gene order, its presence in mature phage, its size, and its conservation across a number of complete genomes of tailed phage that lack other candidate portal proteins. Several other known portal protein families lack clear homology to this family and to each other.
Probab=31.63  E-value=51  Score=29.55  Aligned_cols=42  Identities=12%  Similarity=0.304  Sum_probs=36.6

Q ss_pred             EEEeeCCCC-CCChHHHHHHHHHHHHHHhCCHHHhhccceEEe
Q 033207           60 LVVMEAPKG-YPPRDEIVNGYVKTLASALGCEEDAKKSIYSVS  101 (125)
Q Consensus        60 LVvMe~P~g-~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vS  101 (125)
                      -|.+||+.+ .+.+++-++.+.|-++.++-|.+++.++.|.++
T Consensus       413 ~v~v~fdDsi~~D~e~e~~~~~~~vaaG~ms~~~yl~k~yg~~  455 (476)
T TIGR01542       413 TITIDFDDGVFQDEDTTINRYTNAVNAGMIPLKIALQRAWNIT  455 (476)
T ss_pred             ceEEecCCccccCHHHHHHHHHHHHHcCCCCHHHHHHHccCCC
Confidence            389999998 678888889999999988889999999988754


No 27 
>cd01149 HutB Hemin binding protein HutB.  These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=31.33  E-value=52  Score=24.67  Aligned_cols=20  Identities=25%  Similarity=0.396  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHhCCHHHhhc
Q 033207           76 VNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        76 Id~Yv~TLAkVLGSeeEAkk   95 (125)
                      +..-++.|++++|.|++|++
T Consensus        96 ~~~~~~~lg~i~g~e~~A~~  115 (235)
T cd01149          96 LLTKIRQVAQALGVPEKGEA  115 (235)
T ss_pred             HHHHHHHHHHHhCCHHHHHH
Confidence            44457889999999888765


No 28 
>cd01142 TroA_e Periplasmic binding protein TroA_e.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=30.55  E-value=47  Score=25.65  Aligned_cols=22  Identities=27%  Similarity=0.235  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHhCCHHHhhcc
Q 033207           75 IVNGYVKTLASALGCEEDAKKS   96 (125)
Q Consensus        75 mId~Yv~TLAkVLGSeeEAkkk   96 (125)
                      -+...++.||+++|.+++|++-
T Consensus       122 ~~~~~~~~lg~~~g~~~~a~~~  143 (289)
T cd01142         122 EVKLTIALLGELLGRQEKAEAL  143 (289)
T ss_pred             HHHHHHHHHHHHhCcHHHHHHH
Confidence            3456788999999999888754


No 29 
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.
Probab=30.46  E-value=48  Score=26.08  Aligned_cols=22  Identities=27%  Similarity=0.370  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHhCCHHHhhc
Q 033207           74 EIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        74 emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      +-+...++.+++++|.+++|++
T Consensus       125 ~~~~~~i~~lg~~~G~~~~A~~  146 (289)
T TIGR03659       125 DGMKKSITELGEKYGREEQAEK  146 (289)
T ss_pred             HHHHHHHHHHHHHhCCHHHHHH
Confidence            3344567889999998887754


No 30 
>PHA01078 putative upper collar protein
Probab=30.43  E-value=63  Score=27.49  Aligned_cols=42  Identities=24%  Similarity=0.410  Sum_probs=35.1

Q ss_pred             cccCCCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhCCH
Q 033207           49 SLLEGCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALGCE   90 (125)
Q Consensus        49 ~L~~Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLGSe   90 (125)
                      -+.+.|-.-.++|.-++|.-..+-=+||.+|++-||.+-.|+
T Consensus        52 ~~~d~~~~GnfVV~~NK~~~y~~Dy~IieHY~~elaeia~sr   93 (249)
T PHA01078         52 KLYDNCMSGNFVVMQNKPIQYNSDIEIIEHYTDELAEVALSR   93 (249)
T ss_pred             HHhcccccCCEEEEeccchhhhcchhHHHHHHHHHHHHHHHH
Confidence            466777666778877888888999999999999999998765


No 31 
>cd01146 FhuD Fe3+-siderophore binding domain FhuD.  These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.
Probab=30.08  E-value=79  Score=23.95  Aligned_cols=23  Identities=35%  Similarity=0.354  Sum_probs=15.7

Q ss_pred             ChHHHHHHHHHHHHHHhCCHHHhh
Q 033207           71 PRDEIVNGYVKTLASALGCEEDAK   94 (125)
Q Consensus        71 sr~emId~Yv~TLAkVLGSeeEAk   94 (125)
                      +.+++.+ .++.|++++|.+++|+
T Consensus        97 ~~~~~~~-~i~~lg~~~g~~~~a~  119 (256)
T cd01146          97 WLAEWKE-NLRLIAKALGKEEEAE  119 (256)
T ss_pred             cHHHHHH-HHHHHHHHhCcHHHHH
Confidence            3444444 6788999999887664


No 32 
>PRK03379 vitamin B12-transporter protein BtuF; Provisional
Probab=29.03  E-value=45  Score=26.05  Aligned_cols=20  Identities=20%  Similarity=0.190  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHhCCHHHhhc
Q 033207           76 VNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        76 Id~Yv~TLAkVLGSeeEAkk   95 (125)
                      +...++++++++|.+++|++
T Consensus       109 ~~~~i~~lg~~~g~~~~A~~  128 (260)
T PRK03379        109 IANALRQLAPWSPQPEKAEQ  128 (260)
T ss_pred             HHHHHHHHHHHcCCHHHHHH
Confidence            33457889999998887744


No 33 
>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins.  Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain.
Probab=28.37  E-value=20  Score=24.94  Aligned_cols=50  Identities=22%  Similarity=0.335  Sum_probs=35.4

Q ss_pred             CCCcccCCCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceee
Q 033207           46 RLPSLLEGCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYY  106 (125)
Q Consensus        46 ~~p~L~~Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yf  106 (125)
                      .-|.-|-|+|.--||+  +.=.+.-+|+|.+.+=-+.|.+.+         |++|.-++.|
T Consensus        25 ~~p~~F~GsdlVdWL~--~~~~~~~~R~eAv~~g~~Ll~~G~---------i~HV~~~h~F   74 (84)
T cd04438          25 TIPNSFIGSDLVDWLL--SHVEGLTDRREARKYASSLLKLGY---------IRHTVNKITF   74 (84)
T ss_pred             ECCccccchHHHHHHH--HhCCCCCCHHHHHHHHHHHHHCCc---------EEecCCCccc
Confidence            3567789999999988  433457799998877666665554         7777655443


No 34 
>PF02902 Peptidase_C48:  Ulp1 protease family, C-terminal catalytic domain This family belongs to family C48 of the peptidase classification.;  InterPro: IPR003653 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of proteins contain cysteine peptidases belonging to MEROPS peptidase family C48 (Ulp1 endopeptidase family, clan CE). The protein fold of the peptidase domain for members of this family resembles that of adenain, the type example for clan CE. This group of sequences also contains a number of hypothetical proteins, which have not yet been characterised, and non-peptidase homologues. These are proteins that have either been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of the peptidases in the family. The Ulp1 endopeptidase family contain the deubiquitinating enzymes (DUB) that can de-conjugate ubiquitin or ubiquitin-like proteins from ubiquitin-conjugated proteins. They can be classified in 3 families according to sequence homology [, ]: Ubiquitin carboxyl-terminal hydrolase (UCH) (see PDOC00127 from PROSITEDOC), Ubiquitin-specific processing protease (UBP) (see PDOC00750 from PROSITEDOC), and ubiquitin-like protease (ULP) specific for de-conjugating ubiquitin-like proteins. In contrast to the UBP pathway, which is very redundant (16 UBP enzymes in yeast), there are few ubiquitin-like proteases (only one in yeast, Ulp1). Ulp1 catalyses two critical functions in the SUMO/Smt3 pathway via its cysteine protease activity. Ulp1 processes the Smt3 C-terminal sequence (-GGATY) to its mature form (-GG), and it de-conjugates Smt3 from the lysine epsilon-amino group of the target protein []. Crystal structure of yeast Ulp1 bound to Smt3 [] revealed that the catalytic and interaction interface is situated in a shallow and narrow cleft where conserved residues recognise the Gly-Gly motif at the C-terminal extremity of Smt3 protein. Ulp1 adopts a novel architecture despite some structural similarity with other cysteine protease. The secondary structure is composed of seven alpha helices and seven beta strands. The catalytic domain includes the central alpha helix, beta-strands 4 to 6, and the catalytic triad (Cys-His-Asp). This profile is directed against the C-terminal part of ULP proteins that displays full proteolytic activity [].; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 1EUV_A 2HL8_A 2HKP_A 2HL9_A 1XT9_A 2BKQ_C 2BKR_A 2IO1_E 1TH0_B 1TGZ_A ....
Probab=27.80  E-value=83  Score=22.89  Aligned_cols=30  Identities=27%  Similarity=0.373  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHhCCHHHhhccceEEee
Q 033207           73 DEIVNGYVKTLASALGCEEDAKKSIYSVST  102 (125)
Q Consensus        73 ~emId~Yv~TLAkVLGSeeEAkkkIY~vSt  102 (125)
                      +++||.|++.|.+-+-++.....+++-+++
T Consensus         5 d~iId~y~~~l~~~~~~~~~~~~~~~~~~~   34 (216)
T PF02902_consen    5 DSIIDFYLEYLRHRLESENKNSKRVHFFSS   34 (216)
T ss_dssp             HHHHHHHHHHHHHHTCCTHHTSTTEEEE-T
T ss_pred             HHHHHHHHHHHHHhhccCccCCCcEEEECc
Confidence            689999999999776667777788887775


No 35 
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=27.77  E-value=34  Score=30.02  Aligned_cols=19  Identities=37%  Similarity=0.555  Sum_probs=16.5

Q ss_pred             HHHHHHHhCCHHHhhccce
Q 033207           80 VKTLASALGCEEDAKKSIY   98 (125)
Q Consensus        80 v~TLAkVLGSeeEAkkkIY   98 (125)
                      +++|+++.|-|+||++.+=
T Consensus       159 ~e~Lg~IFgkE~eAk~~~~  177 (320)
T COG4607         159 IETLGKIFGKEEEAKELLA  177 (320)
T ss_pred             HHHHHHHhCchHHHHHHHH
Confidence            5799999999999998763


No 36 
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional
Probab=27.31  E-value=1.4e+02  Score=20.74  Aligned_cols=48  Identities=15%  Similarity=0.103  Sum_probs=33.6

Q ss_pred             EEEeeCCCCCCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceeee
Q 033207           60 LVVMEAPKGYPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYA  107 (125)
Q Consensus        60 LVvMe~P~g~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yfg  107 (125)
                      .|.++.+.....++++.+..-+.|++++|--|+-++--.+-...-+||
T Consensus         5 ~i~tn~~~~~~~~~~~~~~~~~~l~~~lgkPe~~~~v~~~~~~~m~f~   52 (116)
T PTZ00397          5 QVSTNVNATDDQADAALSDIENAIADVLGKPLSYIMSGYDYQKHMRFG   52 (116)
T ss_pred             EEEecCCCccccHHHHHHHHHHHHHHHhCCChHHEEEEEeCCceEEEC
Confidence            355555555667899999999999999997666555444444444444


No 37 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=26.79  E-value=83  Score=19.67  Aligned_cols=42  Identities=5%  Similarity=0.113  Sum_probs=30.5

Q ss_pred             CCChHHHHHHHHHHHHHHhCCHHHhhccceEEeeceeeeeee
Q 033207           69 YPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYAFGC  110 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLGSeeEAkkkIY~vSt~~yfgF~c  110 (125)
                      .-.|.++++.-.+.+++++|--+|+-.-+-.=.-...||||=
T Consensus        14 ~eqk~~l~~~it~~l~~~lg~p~~~v~V~i~e~~~~~w~~gg   55 (64)
T PRK01964         14 EEKIKNLIREVTEAISATLDVPKERVRVIVNEVPSSHWGVAG   55 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHhCcChhhEEEEEEEcChHHeeECC
Confidence            557888999999999999996555554444445566777773


No 38 
>PF01361 Tautomerase:  Tautomerase enzyme;  InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers. The enzyme is part of a plasmid-encoded pathway, which enables bacteria harbouring the plasmid to use various aromatic hydrocarbons as their sole sources of carbon and energy. The enzyme is a barrel-shaped hexamer, which can be viewed as a trimer of dimers. The hexamer contains a hydrophobic core formed by three beta-sheets and surrounded by three pairs of alpha-helices. Each 4-OT monomer of 62 amino acids has a relatively simple beta-alpha-beta fold as described by the structure of the enzyme from Pseudomonas putida []. The monomer begins with a conserved proline at the start of a beta-strand, followed by an alpha-helix and a 310 helix preceding a second parallel beta-strand, and ends with a beta-hairpin near the C terminus. The dimer results from antiparallel interactions between the beta-sheets and alpha-helices of the two monomers, forming a four-stranded beta-sheet with antiparallel alpha-helices on one side, creating two active sites, one at each end of the beta-sheet. Three dimers further associate to form a hexamer by the interactions of the strands of the C-terminal beta-hairpin loops with the edges of the four-stranded beta-sheets of neighbouring dimers, creating a series of cross-links that stabilise the hexamer Pro-1 of the mature protein functions as the general base while Arg-39 and an ordered water molecule each provide a hydrogen bond to the C-2 oxygen of substrate. Arg-39 plays an additional role in the binding of the C-1 carboxylate group. Arg-11 participates both in substrate binding and in catalysis. It interacts with the C-6 carboxylate group, thereby holding the substrate in place and drawing electron density to the C-5 position. The hydrophobic nature of the active site, which lowers the pKa of Pro-1 and provides a favourable environment for catalysis, is largely maintained by Phe-50. Because several Arg residues located near the active site are not conserved among all members of this family and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.; GO: 0016853 isomerase activity, 0006725 cellular aromatic compound metabolic process; PDB: 4OTA_H 4OTC_G 4OTB_J 2FM7_A 1BJP_B 1S0Y_K 3EJ9_E 3EJ7_K 3EJ3_I 3MB2_A ....
Probab=26.38  E-value=91  Score=19.08  Aligned_cols=33  Identities=15%  Similarity=0.425  Sum_probs=23.7

Q ss_pred             EEeeCCCC--CCChHHHHHHHHHHHHHHhCCHHHh
Q 033207           61 VVMEAPKG--YPPRDEIVNGYVKTLASALGCEEDA   93 (125)
Q Consensus        61 VvMe~P~g--~~sr~emId~Yv~TLAkVLGSeeEA   93 (125)
                      |..+-++|  .-.|++++..-.+.+.+++|...|+
T Consensus         3 I~i~~~~g~~~e~K~~l~~~it~~~~~~lg~~~~~   37 (60)
T PF01361_consen    3 ITIKIPEGRTAEQKRELAEAITDAVVEVLGIPPER   37 (60)
T ss_dssp             EEEEEESTS-HHHHHHHHHHHHHHHHHHHTS-GGG
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHhCcCCCe
Confidence            45555555  3457788999999999999986664


No 39 
>cd01140 FatB Siderophore binding protein FatB.  These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=26.24  E-value=64  Score=24.59  Aligned_cols=20  Identities=40%  Similarity=0.582  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHhCCHHHhhc
Q 033207           76 VNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        76 Id~Yv~TLAkVLGSeeEAkk   95 (125)
                      +...++.||+++|.+++|++
T Consensus       109 ~~~~i~~lg~~~g~~~~a~~  128 (270)
T cd01140         109 VKQNIETLGKIFGKEEEAKE  128 (270)
T ss_pred             HHHHHHHHHHHhCcHHHHHH
Confidence            34468999999999888754


No 40 
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=25.49  E-value=80  Score=20.18  Aligned_cols=15  Identities=20%  Similarity=0.457  Sum_probs=12.0

Q ss_pred             hHHHHHHHHHHHHHH
Q 033207           72 RDEIVNGYVKTLASA   86 (125)
Q Consensus        72 r~emId~Yv~TLAkV   86 (125)
                      |+||||+..+-|.++
T Consensus        24 K~EIIeA~~~eL~r~   38 (40)
T PF08776_consen   24 KEEIIEAIRQELSRR   38 (40)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcc
Confidence            678888888888764


No 41 
>PRK10957 iron-enterobactin transporter periplasmic binding protein; Provisional
Probab=25.09  E-value=59  Score=25.79  Aligned_cols=18  Identities=28%  Similarity=0.327  Sum_probs=14.0

Q ss_pred             HHHHHHHHHhCCHHHhhc
Q 033207           78 GYVKTLASALGCEEDAKK   95 (125)
Q Consensus        78 ~Yv~TLAkVLGSeeEAkk   95 (125)
                      ..++.|++++|.+++|++
T Consensus       152 ~~~~~lg~~lg~e~~A~~  169 (317)
T PRK10957        152 ELATQLGEATGLEKQAAA  169 (317)
T ss_pred             HHHHHHHHHhCcHHHHHH
Confidence            336899999999888753


No 42 
>PF02664 LuxS:  S-Ribosylhomocysteinase (LuxS);  InterPro: IPR003815 In bacteria, the regulation of gene expression in response to changes in cell density is called quorum sensing. Quorum-sensing bacteria produce, release, and respond to hormone-like molecules (autoinducers) that accumulate in the external environment as the cell population grows. For example, enteric bacteria use quorum sensing to regulate several traits that allow them to establish and maintain infection in their host, including motility, biofilm formation, and virulence-specific genes []. The LuxS/AI-2 system is one of several quorum sensing mechanisms. AI-2 (autoinducer-2) is a signalling molecule that functions in interspecies communication by regulating niche-specific genes with diverse functions in various bacteria, often in response to population density. LuxS (S-ribosylhomocysteinase; 4.4.1.21 from EC) is an autoinducer-production protein that has a metabolic function as a component of the activated methyl cycle. LuxS converts S-ribosylhomocysteine to homocysteine and 4,5-dihydroxy-2,3-pentanedione (DPD); DPD can then spontaneously cyclise to active AI-2 [, ]. LuxS is a homodimeric iron-dependent metalloenzyme containing two identical tetrahedral metal-binding sites similar to those found in peptidases and amidases []. ; GO: 0005506 iron ion binding, 0009372 quorum sensing; PDB: 1J6X_B 1VGX_A 1INN_B 1VJE_B 1J6V_A 1VH2_A 1J6W_B 1JOE_B 1J98_A 1IE0_A ....
Probab=24.84  E-value=1.1e+02  Score=24.25  Aligned_cols=34  Identities=26%  Similarity=0.458  Sum_probs=28.2

Q ss_pred             CCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhCCH
Q 033207           53 GCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALGCE   90 (125)
Q Consensus        53 Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLGSe   90 (125)
                      ||.--+.|++..    .++.+++++...++|..|++-+
T Consensus        81 GCrTGFYli~~g----~~~~~~i~~l~~~~l~~i~~~~  114 (157)
T PF02664_consen   81 GCRTGFYLILWG----DPSSEDIADLLKETLEFILEFE  114 (157)
T ss_dssp             TTSSEEEEEEES----S--HHHHHHHHHHHHHHHHT-S
T ss_pred             ccccccEEEEeC----CCCHHHHHHHHHHHHHHHHhcC
Confidence            999999999875    5689999999999999999754


No 43 
>cd00636 TroA-like Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between two globular domains linked by a single helix.  Many of these proteins also possess a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).  The TroA-like proteins differ in their fold and ligand-binding mechanism from the PBPI and PBPII proteins, but are structurally similar, however, to the beta-subunit of the nitrogenase molybdenum-iron protein MoFe.   Most TroA-like proteins are encoded by ABC-type operons and appear to function as periplasmic components of ABC transporters in metal ion uptake.
Probab=24.77  E-value=69  Score=20.59  Aligned_cols=25  Identities=32%  Similarity=0.430  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHHhCCHHHhhccc
Q 033207           73 DEIVNGYVKTLASALGCEEDAKKSI   97 (125)
Q Consensus        73 ~emId~Yv~TLAkVLGSeeEAkkkI   97 (125)
                      -+=+...++.+++.+|-++.|++-+
T Consensus        97 ~~~~~~~i~~lg~~~~~~~~a~~~~  121 (148)
T cd00636          97 LENIKESIRLIGKALGKEENAEELI  121 (148)
T ss_pred             HHHHHHHHHHHHHHHCChHHHHHHH
Confidence            4455667899999999999888643


No 44 
>PF14581 SseB_C:  SseB protein C-terminal domain
Probab=24.18  E-value=1.6e+02  Score=20.13  Aligned_cols=35  Identities=11%  Similarity=0.013  Sum_probs=25.9

Q ss_pred             CCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhCC
Q 033207           53 GCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALGC   89 (125)
Q Consensus        53 Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLGS   89 (125)
                      .++-.||+|+.|.++  ...+++++.--+.+...++.
T Consensus        45 ~~~~~~~li~vd~~~--~~~~~~~~~i~~~~~~~~~~   79 (108)
T PF14581_consen   45 EDEQPSLLIGVDFDG--EDIEEIFQEIGRAARPYLPD   79 (108)
T ss_pred             cCCCceEEEEEeccC--hhHHHHHHHHHHHhhhcCCC
Confidence            578889999999987  56666776666666666654


No 45 
>PF01026 TatD_DNase:  TatD related DNase The Pfam entry finds members not in the Prosite definition.;  InterPro: IPR001130 This family of proteins are related to a large superfamily of metalloenzymes []. TatD, a member of this family has been shown experimentally to be a DNase enzyme []. Allantoinase 3.5.2.5 from EC, N-isopropylammelide isopropyl amidohydrolase 3.5.1 from EC and the SCN1 protein from fission yeast belong to this family.; GO: 0016888 endodeoxyribonuclease activity, producing 5'-phosphomonoesters; PDB: 3E2V_B 1XWY_A 3GUW_D 3RCM_A 1ZZM_A 2XIO_A 1J6O_A 2GZX_A 3IPW_A 2Y1H_A ....
Probab=23.44  E-value=1.1e+02  Score=23.92  Aligned_cols=48  Identities=23%  Similarity=0.332  Sum_probs=34.7

Q ss_pred             CCCCcceeEEEeeCCC-------CCCChHHHHHHHHHHHHHHhC-CHHHhhccceE
Q 033207           52 EGCDYKHWLVVMEAPK-------GYPPRDEIVNGYVKTLASALG-CEEDAKKSIYS   99 (125)
Q Consensus        52 ~Gcdy~HWLVvMe~P~-------g~~sr~emId~Yv~TLAkVLG-SeeEAkkkIY~   99 (125)
                      .-+.-+++|+=-|.|-       +.+....+|..=++++|++.| ++||..+.+|.
T Consensus       193 ~~ip~drillETD~P~~~~~~~~~~~~~p~~i~~~~~~la~~~~~~~e~~~~~~~~  248 (255)
T PF01026_consen  193 KAIPLDRILLETDAPYLAPDPYRGKPNEPSNIPKVAQALAEIKGISLEELAQIIYE  248 (255)
T ss_dssp             HHS-GGGEEEE-BTTSSECTTSTTSE--GGGHHHHHHHHHHHHTSTHHHHHHHHHH
T ss_pred             hcCChhhEEEcCCCCcCCccccCCCCCChHHHHHHHHHHHHHcCCCHHHHHHHHHH
Confidence            4455677788777664       356788888989999999999 89999888764


No 46 
>cd00126 PAH Pancreatic Hormone domain, a regulator of pancreatic and gastrointestinal functions; neuropeptide Y (NPY)b, peptide YY (PYY), and pancreatic polypetide (PP) are closely related; propeptide is enzymatically cleaved to yield the mature active peptide with amidated C-terminal ends; receptor binding and activation functions may reside in the N- and C-termini respectively; occurs in neurons, intestinal endocrine cells, and pancreas; exist as monomers and dimers
Probab=23.31  E-value=94  Score=19.25  Aligned_cols=18  Identities=17%  Similarity=0.195  Sum_probs=13.7

Q ss_pred             eCCCCCCChHHHHHHHHH
Q 033207           64 EAPKGYPPRDEIVNGYVK   81 (125)
Q Consensus        64 e~P~g~~sr~emId~Yv~   81 (125)
                      +.|++..|.||+..+|-+
T Consensus         6 ~~Pg~~a~~eel~~Y~~~   23 (36)
T cd00126           6 ENPGDDASPEELRQYLAA   23 (36)
T ss_pred             CCCCCCCCHHHHHHHHHH
Confidence            346678999999887754


No 47 
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glut
Probab=23.00  E-value=91  Score=26.08  Aligned_cols=16  Identities=44%  Similarity=0.675  Sum_probs=13.8

Q ss_pred             C-CHHHhhccceEEeec
Q 033207           88 G-CEEDAKKSIYSVSTK  103 (125)
Q Consensus        88 G-SeeEAkkkIY~vSt~  103 (125)
                      | ++|||+++||-|.-+
T Consensus        52 Gls~e~A~~~i~~vD~~   68 (254)
T cd00762          52 GISKEEACKRIWXVDRK   68 (254)
T ss_pred             CCCHHHHhccEEEECCC
Confidence            5 999999999988654


No 48 
>TIGR03391 FeS_syn_CsdE cysteine desulfurase, sulfur acceptor subunit CsdE. Members of this protein family are CsdE, formerly called YgdK. This protein, found as a paralog to SufE in Escherichia coli, Yersinia pestis, Photorhabdus luminescens, and related species, works together and physically interacts with CsdA (a paralog of SufS). CsdA has cysteine desulfurase activity that is enhanced by this protein (CsdE), in which Cys-61 (numbered as in E. coli) is a sulfur acceptor site. This gene pair, although involved in FeS cluster biosynthesis, is not found next to other such genes as are its paralogs from the Suf or Isc systems.
Probab=22.69  E-value=2.3e+02  Score=21.47  Aligned_cols=46  Identities=28%  Similarity=0.482  Sum_probs=35.8

Q ss_pred             cccCCCCcceeEEEeeCCCC-----CCChHHHHHHHHHHHHHHhC--CHHHhh
Q 033207           49 SLLEGCDYKHWLVVMEAPKG-----YPPRDEIVNGYVKTLASALG--CEEDAK   94 (125)
Q Consensus        49 ~L~~Gcdy~HWLVvMe~P~g-----~~sr~emId~Yv~TLAkVLG--SeeEAk   94 (125)
                      -...||...-|++.-..-+|     .-|-+.||..++..|.+++.  +-+|..
T Consensus        51 ~~V~GCqS~VWl~~~~~~dg~~~f~~dSDa~IvkGl~alL~~~~~g~tp~eI~  103 (138)
T TIGR03391        51 TELTGCENRVWLGHQVLPDGTLHFYGDSEGRIVRGLLAVLLTAVEGKTPEQLL  103 (138)
T ss_pred             hccCCcccceeeeeeecCCCEEEEEecCccHHHHHHHHHHHHHHcCCCHHHHH
Confidence            45789999999986522233     45899999999999999997  566654


No 49 
>PRK14048 ferrichrome/ferrioxamine B periplasmic transporter; Provisional
Probab=22.67  E-value=71  Score=26.24  Aligned_cols=19  Identities=21%  Similarity=0.261  Sum_probs=13.9

Q ss_pred             HHHHHHHHHhCCHHHhhcc
Q 033207           78 GYVKTLASALGCEEDAKKS   96 (125)
Q Consensus        78 ~Yv~TLAkVLGSeeEAkkk   96 (125)
                      .-++.|++++|.||+|++-
T Consensus       166 ~~i~~lG~i~g~ee~A~~l  184 (374)
T PRK14048        166 DNMRLLGKVFEREEQAEDF  184 (374)
T ss_pred             HHHHHHHHHhCCHHHHHHH
Confidence            3467888888888877643


No 50 
>PF11767 SET_assoc:  Histone lysine methyltransferase SET associated;  InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes. This entry represents a domain of unknown function which is associated with the SET domain and found in histone lysine methyltransferases []. 
Probab=22.24  E-value=29  Score=23.48  Aligned_cols=24  Identities=4%  Similarity=0.315  Sum_probs=20.2

Q ss_pred             HhCCHHHhhccceEEeeceeeeee
Q 033207           86 ALGCEEDAKKSIYSVSTKYYYAFG  109 (125)
Q Consensus        86 VLGSeeEAkkkIY~vSt~~yfgF~  109 (125)
                      |.++.+||++|.+.++.+.-|++.
T Consensus        39 vF~~~~Ea~rC~~~~~~~~~f~y~   62 (66)
T PF11767_consen   39 VFNDSKEAERCFRAEDGTLFFTYR   62 (66)
T ss_pred             EECChHHHHHHHHhcCCCEEEEEE
Confidence            456778999999999999888775


No 51 
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=21.98  E-value=70  Score=28.03  Aligned_cols=28  Identities=29%  Similarity=0.488  Sum_probs=22.8

Q ss_pred             CCChHHHHHHHHHHHHHHhCCHHHhhccc
Q 033207           69 YPPRDEIVNGYVKTLASALGCEEDAKKSI   97 (125)
Q Consensus        69 ~~sr~emId~Yv~TLAkVLGSeeEAkkkI   97 (125)
                      .-+-+|-||++ +|.|+.||-|+|-++++
T Consensus       142 ~~dY~eni~s~-~tIakavgKekE~ekrL  169 (310)
T COG4594         142 NEDYQENIDSF-KTIAKAVGKEKEMEKRL  169 (310)
T ss_pred             CccHHHHHHHH-HHHHHHhCchHHHHHHH
Confidence            34567888886 78999999999988775


No 52 
>COG1854 LuxS LuxS protein involved in autoinducer AI2 synthesis [Signal transduction mechanisms]
Probab=21.67  E-value=1.8e+02  Score=23.46  Aligned_cols=32  Identities=22%  Similarity=0.562  Sum_probs=28.9

Q ss_pred             CCCcceeEEEeeCCCCCCChHHHHHHHHHHHHHHhC
Q 033207           53 GCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALG   88 (125)
Q Consensus        53 Gcdy~HWLVvMe~P~g~~sr~emId~Yv~TLAkVLG   88 (125)
                      ||..-+.|++.    |.++.++++|....++..||+
T Consensus        81 GCrTGFYm~l~----G~~~~~~i~~~~~~~m~dvl~  112 (161)
T COG1854          81 GCRTGFYMILI----GTPTSQDIADVLEATMKDVLK  112 (161)
T ss_pred             ccccceEEEEE----CCCCHHHHHHHHHHHHHHHHc
Confidence            89999999987    467889999999999999997


No 53 
>TIGR02778 ligD_pol DNA polymerase LigD, polymerase domain. DNA repair of double-stranded breaks by non-homologous end joining (NHEJ) is accomplished by a two-protein system that is present in a minority of prokaryotes. One component is the Ku protein (see TIGR02772), which binds DNA ends. The other is a DNA ligase, a protein that is a multidomain polypeptide in most of those bacteria that have NHEJ, a permuted polypeptide in Mycobacterium tuberculosis and a few other species, and the product of tandem genes in some other bacteria. This model represents the polymerase domain.
Probab=21.47  E-value=83  Score=26.31  Aligned_cols=22  Identities=9%  Similarity=0.031  Sum_probs=17.4

Q ss_pred             CCCCCCChHHHHHHHHHHHHHH
Q 033207           65 APKGYPPRDEIVNGYVKTLASA   86 (125)
Q Consensus        65 ~P~g~~sr~emId~Yv~TLAkV   86 (125)
                      +|+...||.|.|+||.+.=--.
T Consensus        11 ~P~~g~TK~dl~~YY~~va~~m   32 (245)
T TIGR02778        11 WPAEGITKLDLADYYAAVAPFM   32 (245)
T ss_pred             cCCCCCcHHHHHHHHHHHHHHH
Confidence            4667899999999999864433


No 54 
>cd01138 FeuA Periplasmic binding protein FeuA.  These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=21.07  E-value=90  Score=23.44  Aligned_cols=22  Identities=23%  Similarity=0.327  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHhCCHHHhhc
Q 033207           73 DEIVNGYVKTLASALGCEEDAKK   95 (125)
Q Consensus        73 ~emId~Yv~TLAkVLGSeeEAkk   95 (125)
                      +++. ..++.|++++|-+++|++
T Consensus        97 ~~~~-~~i~~lg~~~g~~~~a~~  118 (248)
T cd01138          97 SDWE-EQLKEIGKLLNKEDEAEK  118 (248)
T ss_pred             CCHH-HHHHHHHHHhCcHHHHHH
Confidence            3443 457999999999888765


No 55 
>PF07105 DUF1367:  Protein of unknown function (DUF1367);  InterPro: IPR009797 This entry is represented by Bacteriophage VT2phi_272, P37. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several highly conserved, hypothetical bacterial and phage proteins of around 200 resides in length. The function of this family is unknown.
Probab=21.04  E-value=78  Score=25.97  Aligned_cols=34  Identities=38%  Similarity=0.620  Sum_probs=25.8

Q ss_pred             CCCcceeEEEeeCCCCCCChHH--HHHHHHHHHHHHhCCH
Q 033207           53 GCDYKHWLVVMEAPKGYPPRDE--IVNGYVKTLASALGCE   90 (125)
Q Consensus        53 Gcdy~HWLVvMe~P~g~~sr~e--mId~Yv~TLAkVLGSe   90 (125)
                      -+-++||    ++-+|.+|++|  +|..|++-||...|++
T Consensus        55 ~lgFeyW----~P~gg~is~~E~~lv~g~v~~la~~~g~~   90 (196)
T PF07105_consen   55 NLGFEYW----EPTGGTISPAERKLVRGFVKFLASYAGSE   90 (196)
T ss_pred             HHHHHHc----cCCCCccCHHHHHHHHHHHHHHHHHhCCH
Confidence            3558999    33345566554  7999999999999987


No 56 
>TIGR02145 Fib_succ_major Fibrobacter succinogenes major paralogous domain. This domain of about 175 to 200 amino acids is found, in from one to five copies, in over 50 proteins in Fibrobacter succinogenes S85, an obligate anaerobe of the rumen. Many members of this family have an apparent lipoprotein signal sequence. Conserved cysteine residues, suggestive of disulfide bond formation, are also consistent with an extracytoplasmic location for this domain. This domain can also be found in small numbers of proteins in Chlorobium tepidum and Bacteroides thetaiotaomicron.
Probab=20.89  E-value=54  Score=25.49  Aligned_cols=36  Identities=31%  Similarity=0.569  Sum_probs=25.6

Q ss_pred             ceeEEEee--CCCC--CCChHHHHHHHHHHHHHHhCCHHHhhccc
Q 033207           57 KHWLVVME--APKG--YPPRDEIVNGYVKTLASALGCEEDAKKSI   97 (125)
Q Consensus        57 ~HWLVvMe--~P~g--~~sr~emId~Yv~TLAkVLGSeeEAkkkI   97 (125)
                      =-|-.+||  -|.|  .||++|     -++|.+.+|..+.|-.++
T Consensus        50 Y~w~aa~~~~cP~GWhlPs~~E-----w~~L~~~~g~~~~ag~~L   89 (171)
T TIGR02145        50 YTWAAAMDSICPEGWHLPSTTE-----WNTLFDAVGGKVNAGGKL   89 (171)
T ss_pred             EEHHHhccCcCCCCCCCCCHHH-----HHHHHHHhccccchhhhh
Confidence            36889999  4998  899999     356666777655544443


No 57 
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]
Probab=20.46  E-value=65  Score=28.35  Aligned_cols=74  Identities=19%  Similarity=0.267  Sum_probs=51.9

Q ss_pred             cccCCCCcceeEEEeeCCCC----------CCChHHHHHHHHHH------HHHHhCCHHHhhccceEEeec----eeeee
Q 033207           49 SLLEGCDYKHWLVVMEAPKG----------YPPRDEIVNGYVKT------LASALGCEEDAKKSIYSVSTK----YYYAF  108 (125)
Q Consensus        49 ~L~~Gcdy~HWLVvMe~P~g----------~~sr~emId~Yv~T------LAkVLGSeeEAkkkIY~vSt~----~yfgF  108 (125)
                      .|--|-.++-|...|++-++          .++-.|||||-++|      |---+||.+++++-+|..--+    .-|--
T Consensus        58 ~l~~geh~epwFmrlNp~gevPVl~~g~~II~d~tqIIdYvErtf~ger~l~pe~~S~~~d~~l~~e~~l~~lpm~~~t~  137 (325)
T KOG4420|consen   58 SLPQGEHKEPWFMRLNPGGEVPVLIHGDNIISDYTQIIDYVERTFTGERVLMPEVGSLQHDRVLQYEELLDALPMDAYTH  137 (325)
T ss_pred             cCccccccCchheecCCCCCCceEecCCeecccHHHHHHHHHHhhcccccccccccccccHHHHHHHHHHHhcCcchhhc
Confidence            44457788889999996442          36889999999984      556678999999988865321    23446


Q ss_pred             eeeeehhhc-cccCC
Q 033207          109 GCKFLKILL-IRSDP  122 (125)
Q Consensus       109 ~c~I~Ee~S-lk~lP  122 (125)
                      ||-|.-|+. ..-.|
T Consensus       138 g~~lh~eL~~~s~iP  152 (325)
T KOG4420|consen  138 GCILHPELTTDSMIP  152 (325)
T ss_pred             cccccchhhccccCc
Confidence            777777766 44444


No 58 
>PRK15019 CsdA-binding activator; Provisional
Probab=20.24  E-value=2.6e+02  Score=21.45  Aligned_cols=46  Identities=24%  Similarity=0.460  Sum_probs=35.7

Q ss_pred             cccCCCCcceeEEEeeCCCC-----CCChHHHHHHHHHHHHHHhC--CHHHhh
Q 033207           49 SLLEGCDYKHWLVVMEAPKG-----YPPRDEIVNGYVKTLASALG--CEEDAK   94 (125)
Q Consensus        49 ~L~~Gcdy~HWLVvMe~P~g-----~~sr~emId~Yv~TLAkVLG--SeeEAk   94 (125)
                      -...||...-|++....-+|     .-|-+.||..++..|..++.  +-+|..
T Consensus        56 ~~V~GCqS~VWL~~~~~~dg~~~f~~dSDA~IvkGl~alL~~~~~g~tp~eIl  108 (147)
T PRK15019         56 KEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQ  108 (147)
T ss_pred             CcCCCcccceeeeeeecCCCEEEEEeeCccHHHHHHHHHHHHHHcCCCHHHHH
Confidence            56789999999975543333     34899999999999999997  566654


Done!