Citrus Sinensis ID: 033221


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MTNSNYIELSQLYDKYKDQGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKIDVNGEHASPLYKLLKSGKWGIFGDDIQWNFAKFLVDKNGQVVDRYYPTTSLLSLEHDIKKLLGLS
cccccHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHcccccccccccEEcccccccHHHHHHHccccccccccccccccccEEcccccEEEECcccccHHHHHHHHHHHHccc
MTNSNYIELSQLYDKYKDQGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKIDVNGEHASPLYKLLKSGKWGIFGDDIQWNFAKFLVDKNGQVVDRYYPTTSLLSLEHDIKKLLGL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNSNYIELSQLYDKYKDQGLEILAFPCNQFGEEEPGSNDQIADFVCTRFKSEFPIFEKIDVNGEHASPLYKLLKSGKWGIFGDDIQWNFAKFLVDKNGQVVDRYYPTTSLLSLEHDIKKLLGLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glutathione peroxidase 8 May constitute a glutathione peroxidase-like protective system against oxidative stresses.probableQ8LBU2
Glutathione peroxidase 1 May constitute a glutathione peroxidase-like protective system against oxidative stresses.probableO23970
Glutathione peroxidase 2 May constitute a glutathione peroxidase-like protective system against oxidative stresses.probableP38143

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5Q, chain A
Confidence level:very confident
Coverage over the Query: 3-125
View the alignment between query and template
View the model in PyMOL