Citrus Sinensis ID: 033227

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----

MATIPLRKGNARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRIGSSKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQTKMSKKFDQKKKDDELAKMQEKYGVSTKDK

cccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEEEEccccccccEEEEEEccHHHHHHHHHHHcccEEcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccc

****************VNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRIGSSKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQ******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MATIPLRKGNARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRIGSSKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQTKMSKKFDQKKKDDELAKMQEKYGVSTKDK

Annotation	Function Description	Confidence Level	Reference Protein
Pre-mRNA branch site p14-like protein	May be necessary for the splicing of pre-mRNA.	confident	Q9FMP4
Pre-mRNA branch site protein p14	Necessary for the splicing of pre-mRNA. Directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing. Enters the spliceosome and associates with the pre-mRNA branch site as part of the 17S U2 or, in the case of the minor spliceosome, as part of the 18S U11/U12 snRNP complex, and thus may facilitate the interaction of these snRNP with the branch sites of U2 and U12 respectively.	probable	Q9Y3B4
Pre-mRNA branch site p14-like protein	Necessary for the splicing of pre-mRNA.	probable	Q8ITY4

No EC number assigned to the protein, probably not an enzyme!

Template: 3LQV, chain A
Confidence level:very confident
Coverage over the Query: 13-123
View the alignment between query and template
View the model in PyMOL