Citrus Sinensis ID: 033241

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----

MASSKGGGMEKMSVEQLKAIKEQTDLEVNLLQDSLNNIRTATSRLESASTALHDLSLRPQGAKMLVPLTASLYVPGTLDDARKVLVDIGTGYFVEKTMDEGKDYCERKINLLKSNFDQLIEVRF

cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEEccccEEEEEEEccccEEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccc

*******************I*EQTDLEVNLLQDSLNNIRTATSRLESASTALHDLSLRPQGAKMLVPLTASLYVPGTLDDARKVLVDIGTGYFVEKTMDEGKDYCERKINLLKSNFDQLIEVRF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSKGGGMEKMSVEQLKAIKEQTDLEVNLLQDSLNNIRTATSRLESASTALHDLSLRPQGAKMLVPLTASLYVPGTLDDARKVLVDIGTGYFVEKTMDEGKDYCERKINLLKSNFDQLIEVRF

Annotation	Function Description	Confidence Level	Reference Protein
Probable prefoldin subunit 5	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.	confident	P57742
Prefoldin subunit alpha	Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding.	probable	A1RXA9

No EC number assigned to the protein, probably not an enzyme!

Template: 1FXK, chain C
Confidence level:very confident
Coverage over the Query: 13-122
View the alignment between query and template
View the model in PyMOL