Citrus Sinensis ID: 033242


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MDFSPLTDALASKSYEKIADICDDLMLKVAAEGIVFQDEWPYVIHLLGYYYVNDINSARFLWKSIPSTIKDSRAEVVAAWKIGQHLWTRDYAGVYDAIRGFDWSQEAQALVAAFSGACTKSSCS
ccccHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
*****LT*ALASKSYEKIADICDDLMLKVAAEGIVFQDEWPYVIHLLGYYYVNDINSARFLWKSIPSTIKDSRAEVVAAWKIGQHLWTRDYAGVYDAIRGFDWSQEAQALVAAFSGACTKS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFSPLTDALASKSYEKIADICDDLMLKVAAEGIVFQDEWPYVIHLLGYYYVNDINSARFLWKSIPSTIKDSRAEVVAAWKIGQHLWTRDYAGVYDAIRGFDWSQEAQALVAAFSGACTKSSCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COP9 signalosome complex subunit 8 Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.probableP43255

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T5V, chain A
Confidence level:probable
Coverage over the Query: 33-122
View the alignment between query and template
View the model in PyMOL