Citrus Sinensis ID: 033251

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKHATTVENATTANA
ccccccEEEEEcHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHccccccccccc
****GQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAV***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKHATTVENATTANA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin H-type Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The H form is known to activate a number of cytosolic enzymes.probableQ43636
Thioredoxin H1 Thiol-disulfide oxidoreductase involved in the redox regulation of MAP kinases. Under reducing conditions, inhibits MPK1 and MPK5 kinase activities. Mediates its own transport from cell-to-cell through plasmodesmata. Possesses insulin disulfide bonds reducing activity.probableQ0D840
Thioredoxin H1 Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes. Activates the cytosolic malate dehydrogenase (MDH) probably by reducing an interchain disulfid bond of the inactive MDH homodimer. Possesses insulin disulfide bonds reducing activity.probableP29448

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TI3, chain A
Confidence level:very confident
Coverage over the Query: 3-113
View the alignment between query and template
View the model in PyMOL